KEGG   Brachybacterium sp. P6-10-X1: BH708_14880Help
Entry
BH708_14880       CDS       T04713                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00903  Limonene and pinene degradation
brx00930  Caprolactam degradation
brx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BH708_14880
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BH708_14880
Enzymes [BR:brx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BH708_14880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Peptidase_S9 Say1_Mug180
Motif
Other DBs
NCBI-ProteinID: APX33782
UniProt: A0A1P8NHI0
Position
3358048..3358863
Genome map
AA seq 271 aa AA seqDB search
MSIVRTLRILASQRPSTPPRSVAAPARVTRARPGHVPVTWIDQQLAATGTIVHLHGGAYV
SGEQKAHWSWLEEVGRRAGAATAMVHYRMAPKHPFPTAVEDVLAALDGMGEASLLRAGRW
VLSGDSAGGGLALAVAQSLAQGHADTPALLMLESPWTDLPARRDGEDELRRAAARLYAGA
VPPTDPRLSPIHGDLGALPPVHLVAGAEDELIEDSRRLHAGLIEAGTDVGYVEIPGQGHT
VAVTGEGPDAQAARRTQIEAARRALTLRAAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgtccgcacgctgcgcatcctggcgtcccagcgcccgtccacccctcctcgc
tccgtcgcggccccggctcgcgtcacgcgcgcccgacccggccacgtgcccgtgacctgg
atcgaccagcagctggcggcgaccggcacgatcgtgcacctgcacgggggcgcgtacgtc
tccggggagcagaaggcccattggtcctggctcgaggaggtgggccgacgtgccggcgcc
gccaccgcgatggtccactaccggatggccccgaagcatcccttccccaccgcggtcgag
gacgtgctggccgccctggacggcatgggcgaggcgtccctgctgcgtgcgggccgctgg
gtgctctccggcgacagcgccggcggcggcctcgcgctcgccgtcgcccagtccctggcc
cagggccacgccgacacccccgcactgctgatgctcgaatcgccctggacggatctgccc
gcccgccgcgacggcgaggacgagctgcgtcgcgccgcggcccgcctctatgccggcgcc
gtgccgccgacggacccgcgcctcagccctatccacggagacctcggcgccctgccgccc
gtgcacctcgtcgccggtgccgaggacgagctgatcgaggactcccgccgtctgcacgcg
ggcctgatcgaggccggcaccgacgtgggatacgtcgagatccccggccaggggcacacc
gtcgcggtcaccggcgaggggccggatgcccaggccgcccgccgcacccagatcgaggcc
gctcggcgcgccctcaccctccgcgcggccgcctga

DBGET integrated database retrieval system