KEGG   Brachybacterium sp. P6-10-X1: BH708_17520Help
Entry
BH708_17520       CDS       T04713                                 

Definition
(GenBank) phosphate starvation-inducible protein PhoH
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
brx  Brachybacterium sp. P6-10-X1
Brite
KEGG Orthology (KO) [BR:brx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BH708_17520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1378
Motif
Other DBs
NCBI-ProteinID: APX34205
UniProt: A0A1P8NIR2
Position
complement(3971495..3972511)
Genome map
AA seq 338 aa AA seqDB search
MTPGLLVVVVVLALVMAFYNGFHDASNAVSTTITTRSLRESTALGMAAILNLLGALLGML
LLSVTAEWALALLGLRRLAESTAGAPDVLGAGLIAIMLATLAWEVLTWWIGMPSSTWHSF
FGGALGASLAIGAAAAWNHLVEILVASLVGPLIAVVLAYVVMQGLLALARNERLGVAHIR
FAQTVSAGAVATGHGLSDARLPLAVIVVATSVSGLSAGSSLTVMSAVAVAVAAGTLLGGH
RIIRTIGRRLTDLSAAQGLAAESSAVISMSVALFGLDSPVSSSHGLASSVVGAGVAMGPR
HVRWPVARTMVLTWLATPIATAVLGAALAGLMLEVAAG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcccggactgctcgtcgtggtcgtcgtcctggcgctggtgatggcgttctacaac
ggcttccacgacgcctccaacgcggtctccaccaccatcaccacccggtccctgcgggaa
tcgacggccctggggatggccgcgatcctcaacctgctcggcgcgctgctgggcatgctt
ctgctgtccgtgaccgccgagtgggcgctcgcactgctggggctgcgccgcctggcggag
agcaccgccggcgcaccggacgtgctcggcgcggggttgatcgcgatcatgctggccacc
ctggcctgggaggtgctgacgtggtggatcggcatgccgtcctcgacctggcactccttc
ttcggcggcgccctcggagcctcgctggcgatcggcgcggcagccgcctggaaccatctg
gtggagatcctggtcgcctcgctcgtcggcccgctgatcgccgtggtcctggcatacgtc
gtgatgcagggcctgctggcgctggcccgcaacgagcgcctgggcgtggcccacatccgc
ttcgcccagaccgtctccgccggtgcggtcgccaccgggcacgggctcagcgacgcccgc
ctccccctggccgtcatcgtcgtggcgacctccgtctcgggcctgtcggccggctcctcc
ctgacggtgatgtcggcggtggccgtcgccgtggccgcgggcaccctgctgggcgggcac
cggatcatccgcacgatcggccgtcgcctcacggatctctcggccgcccagggtctggcc
gcggagtcctccgcggtgatctcgatgtccgtcgcgctgttcggcctggactcccccgtg
tcctcctcgcacggcctcgcctcgagcgtggtcggcgccggcgtcgccatggggccgcgg
catgtgcgctggccggtggcgcgcacgatggtcctgacctggctcgcgacgccgatcgcg
accgccgtgctcggagccgctctggccggattgatgctcgaggtcgccgcagggtga

DBGET integrated database retrieval system