KEGG   Brachybacterium sp. P6-10-X1: BH708_19150Help
Entry
BH708_19150       CDS       T04713                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00471  D-Glutamine and D-glutamate metabolism
brx00550  Peptidoglycan biosynthesis
brx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BH708_19150 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BH708_19150 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:brx01011]
    BH708_19150 (murD)
Enzymes [BR:brx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BH708_19150 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:brx01011]
 Precursor biosynthesis
  Amino acid ligase
   BH708_19150 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DFP TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: APX34476
UniProt: A0A1P8NJH4
Position
4339003..4340496
Genome map
AA seq 497 aa AA seqDB search
MSAPVADRPWPGLDVSGVSILVAGFGVSGYAVADQTMQRGADVLVVDGAETPEIRERAEV
LEVLGVEVRLGGEHALVLPSDRAVDLVVTSPGWRPDQPLLAAAAAAGIPIWSEVELARRM
QSADGPDWLAVTGTNGKTTTVTMLESILQQAGLRAVACGNVGLPVIEAALDPEGFDVLAI
ELSSFQLHWTEHLDCEAAAVLNVSPDHLDWHGGAAEYARAKGRIFEGVSTACVYNTADVI
TRELVEDADVREGARAVGLTLGSPGLSELGVVDGMLVDRAFLTQRRTSAAELATLEDLAH
LGPQGAGPHVVLDALAAAALARAHGIQAIAIRDGLRAYRMGSHRAQLLATIEGISYVDDT
KATNPAAASASLRAAERIVWIAGGDTKGADLDELVGQVRDRLVGVVLLGADERPFTAALT
RHAPEVPVRRVDPGDTDDVAGRSRLMEDAVRAARSLASAGDVVLLAPAAASIDQFRDYAE
RGDLFAAAVTRGPGASS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcccgtcgcggatcgtccctggcccggactcgacgtctccggggtgtcgatc
ctggtcgccgggttcggcgtctccggctacgcggtggccgaccagaccatgcagcgcggc
gccgacgtgctcgtcgtcgacggcgccgagacccctgagatccgcgagcgtgccgaggtc
ctcgaggtcctcggcgtcgaggtccgtctgggcggcgagcacgccctcgtcctgccgagc
gaccgcgccgtcgacctcgtggtcacctcgcccggctggcgccccgaccagcccttgctg
gccgccgcggccgcagcggggatcccgatctggagcgaggtcgagctggcccggcgcatg
cagagcgccgacggccccgactggctggccgtcaccggcaccaacggcaagaccaccacg
gtcaccatgctcgaatcgatcctccagcaggcgggactgcgcgccgtcgcctgcggcaac
gtgggccttcccgtgatcgaggcggccctggaccccgagggcttcgacgtgctcgccatc
gagctctccagcttccagctgcactggaccgagcacctggactgcgaggcggcagccgtg
ctgaacgtcagccccgaccatctggactggcacggcggtgccgcggagtacgcccgcgcc
aagggccggatcttcgagggtgtgagcaccgcctgcgtctacaacacggccgacgtgatc
acccgggagctggtcgaggacgccgacgtccgcgagggcgcccgcgccgtcggcctcacg
ctgggatccccggggctctccgagctcggggtcgtcgacggcatgctcgtcgaccgggcg
ttcctcacccagcggcgcacgtccgcggcggagctcgcgaccctcgaggacctcgcgcac
ctgggcccgcagggcgccggcccccacgtcgtgctcgacgccctcgccgccgcggccctg
gcccgcgcccacggcatccaggcgatcgcgatccgcgacgggctgcgggcctaccggatg
ggcagccaccgcgcccagctgctggccacgatcgagggcatcagctacgtcgatgacacc
aaggccaccaaccccgcggccgcctccgcctcgctgcgcgcggccgagcggatcgtgtgg
atcgccggcggcgacaccaagggcgcggacctcgacgagctcgtcggccaggtccgcgac
cggctggtcggggtggtcctgctgggggccgacgagcggccgttcaccgctgccctgacg
cgacacgcccccgaggtccccgtccgccgggtcgatccgggtgacactgacgacgtcgcc
gggcgctcccgactcatggaggacgcggtgcgggccgcacgatccctcgcctcggccggg
gacgtggtgctgctggcaccggccgcagcctccatcgatcagttccgtgactatgcggaa
cggggggatctgttcgcggcggccgtgacccgagggccaggagcgagctcatga

DBGET integrated database retrieval system