KEGG   Brachybacterium sp. VM2412: CFK38_13340Help
Entry
CFK38_13340       CDS       T05108                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00260  Glycine, serine and threonine metabolism
brz00630  Glyoxylate and dicarboxylate metabolism
brz00670  One carbon pool by folate
brz01100  Metabolic pathways
brz01110  Biosynthesis of secondary metabolites
brz01130  Biosynthesis of antibiotics
brz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFK38_13340 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFK38_13340 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CFK38_13340 (gcvT)
Enzymes [BR:brz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CFK38_13340 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG DUF5419
Motif
Other DBs
NCBI-ProteinID: ATG52393
UniProt: A0A291GPG9
Position
complement(2969317..2970450)
Genome map
AA seq 377 aa AA seqDB search
MPDQDLRSTALAAVHEALGATFTDFAGWRMPVRYDSDLAEHRAVRESAGIFDLSHMGEIH
LRGPQAGDALDHALAGKLSAMSVGRAKYSLLLTEDGGVIDDVITYRLSAEHFLVVANAAN
AEVDAAELSARAQGFDVEVDDASARTSLIAVQGPASEQILGDALLGSDSGVESLAAADLS
GMKNYRFAESTYRGEPMLIARTGYTGEDGFELYVPNELAAGLWEQLTAAGGDRLVPCGLA
CRDTLRLEAGMPLYGNELGRDLYPAQSGMGRVVALTSKGDFVGRAGIEAADMSDRPVLVG
LAADGRRAARAGAQVRDADGHEVGAITSGVLSPTLGHPIAMGFVSASAAEVGTVLVADVR
GKDLPVRVVTTPFYSRD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccaggacctgcgcagcaccgccctcgcggcggtccacgaggcgctcggcgcg
acgttcaccgacttcgccggctggcgcatgcccgtgcggtacgactccgatctcgccgag
caccgggccgtgcgcgagagcgccggcatcttcgatctcagccacatgggcgagatccac
ctgcgcggcccccaggccggggacgccctggaccacgccctggccggcaagctctcggcg
atgtccgtggggcgcgcgaagtactcgctgctgctcaccgaggacggcggtgtgatcgac
gacgtcatcacctaccggctctccgcggagcacttcctggtggtcgccaacgcggccaac
gccgaggtcgatgccgccgagctcagcgcccgtgcgcagggcttcgacgtcgaggtcgac
gacgcctccgcccgcacctcgctgatcgccgtgcagggtccggcgagcgagcagatcctg
ggcgacgcactgctcggcagcgacagcggggtcgagtccctggctgccgcggacctcagc
gggatgaagaactaccgcttcgccgagagcacctatcgcggggagccgatgctgatcgcc
cgcaccggctacaccggtgaggacggcttcgagctgtacgtcccgaacgagctcgccgcc
gggctctgggagcagctgaccgcagccggcggcgaccgcctggtcccgtgcggactcgcc
tgccgcgacaccctgcgcctcgaggccgggatgccgctgtacggcaacgagctgggccgc
gacctgtaccccgcccagtcgggcatgggccgcgtggtcgcgctgacgtccaagggcgac
ttcgtcggccgcgccggcatcgaggccgcggacatgtccgaccgcccggtcctggtgggc
ctggccgccgacggccgtcgggccgcgcgggccggtgcccaggtgcgcgatgcggacgga
cacgaggtcggagcgatcacctccggtgtcctgtccccgaccctcggccaccccatcgcg
atgggcttcgtgtccgcgagcgccgccgaggtcggcaccgttctggtggccgacgtgcgc
ggcaaggacctcccggtgcgcgtcgtgacgacgccgttctactcccgcgactga

DBGET integrated database retrieval system