KEGG   Brachybacterium sp. VM2412: CFK38_14640Help
Entry
CFK38_14640       CDS       T05108                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00450  Selenocompound metabolism
brz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFK38_14640 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:brz03016]
    CFK38_14640 (selD)
Enzymes [BR:brz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CFK38_14640 (selD)
Transfer RNA biogenesis [BR:brz03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CFK38_14640 (selD)
 Prokaryotic Type
    CFK38_14640 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C
Motif
Other DBs
NCBI-ProteinID: ATG52624
UniProt: A0A291GRQ6
Position
3261313..3262332
Genome map
AA seq 339 aa AA seqDB search
MSVHPIRSVAQPSIRLTTMAHGGGCASKIPPGELEEVVSALSGPQYEQVIVGLDDGDDAA
AVRIGGADGDTAVLSTADFFAPVVDDAFDWGRIAAANALSDIYAMGGDPVVAINLVGWPR
GVLPYELLQEVLAGGLAIAQEAGVPVIGGHSVDDPEPKYGMAVTGTAPADRLLRNDAARP
GLPITLTKPLGVGLLNNRMRATGEVSAAAIETMTALNRDAAQAALAAGARAATDVTGFGL
LGHLHKMVRASGIGAVLNRSAVPLIEGAAEALADGYVSGGTRRNLDWVREHVQTGPGITE
EDLLLLADAQTSGGLLVVGEVPGYPIIGETLEGAGIGVC
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcacccgatccgttccgtggcccagccctcgatccgtctgaccacgatggcg
cacggcggcggctgcgcctcgaagatccctccgggtgagctcgaggaggtggtctcggca
ctctccggtccgcagtacgagcaggtgatcgtggggttggacgacggcgacgacgccgcc
gcggtgcggatcggcggggccgatggggacactgcggtgctctcgaccgcggacttcttc
gccccggtggtcgacgacgccttcgactggggccgcatcgccgccgccaacgccctgtcg
gacatctacgccatgggcggcgacccggtggtcgcgatcaacctggtgggctggccccgc
ggggtcctgccctacgagctgctgcaggaggtcctcgcgggcgggctggcgatcgcacag
gaggccggggtgccggtgatcggcgggcactcggtcgatgacccggagccgaaatacggc
atggcggtcacgggcaccgcgcccgcggaccgcctgctgcgcaacgacgccgcccgaccg
ggcctgccgatcaccctcaccaagcccctcggcgtgggcctgctgaacaaccgcatgcga
gccaccggggaggtctcggcggcggcgatcgagaccatgaccgccctgaaccgggacgcc
gcgcaggcggcgctggccgccggggcccgggcggcgacggacgtgaccggcttcgggctg
ctgggccacctgcacaagatggtgcgcgcctcggggatcggggcggtgctgaaccggtcg
gcggtgccgctgatcgagggggcggcggaggcgctggccgacgggtacgtctccggcggg
acccgccgcaacctggactgggtgcgcgagcacgtgcagacggggccgggcatcaccgag
gaggacctgctgctgctggccgacgcgcagacctctggcggactgctggtggtgggcgag
gtgcccggctatccgatcatcggcgagaccctggagggggcgggcattggcgtgtgctga

DBGET integrated database retrieval system