KEGG   Bacteroides salanitronis: Bacsa_0673Help
Entry
Bacsa_0673        CDS       T01433                                 

Definition
(GenBank) Phenylacetate--CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00360  Phenylalanine metabolism
bsa01100  Metabolic pathways
bsa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Bacsa_0673
Enzymes [BR:bsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     Bacsa_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding GH3 EFF-AFF
Motif
Other DBs
NCBI-ProteinID: ADY35267
UniProt: F0R112
Position
complement(717336..718649)
Genome map
AA seq 437 aa AA seqDB search
MKHESMYLHPELETMPRSEINRLQMERLQQTLQRCMCIPFYKQRFAEIGLKPEDIHTLDD
LQKIPFTTKQDLREHYPFGLSAVPLEKVVRLHSSSGTTGTPTVILHTQHDLDEWANAVAR
CLYMVGLRKGDIFQNSSGYGMFTGGLGFQYGAERLGMLTVPAAAGNTKRQIKFITDFGTT
ALHAIPSYAGRLYEVMEEMGIDPRRDTKLRTLIIGAEPHSDEQRRRIEDMLGVKAYNSFG
MSEMCGPGVAFECPEQNGLHIWEDYYIVEIVNPDTLEPVPEGEIGELVLTTINREAMPLL
RYRTRDLTRILPGDCPCGRHHKRLDRMKGRSDDMMILKGVNIFPIQIENILMQFKELGNE
YLITLTNLEANDEMTVEVELNDFTDDYGFLQRLTKEITRQLKDEILITPRVKLVPKGSLP
KQEGKAVRVKDLRKTLI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgaatctatgtatttacatccggaactggagactatgcctcggtcggaaatc
aaccggctccagatggagaggctgcaacagactttacaacggtgtatgtgtattcctttt
tataagcagcgttttgctgaaatagggctgaaaccagaagatatacatacattagacgac
ttgcagaagataccgtttactaccaagcaagatttgcgcgagcactatcctttcgggctt
tctgccgttccattggaaaaagtggtgcgcttgcattcttccagcgggacaacaggcaca
ccaaccgttattcttcatacccagcacgatttggacgagtgggcgaatgctgtagcacgt
tgcctgtatatggtaggattacgcaaaggggatattttccagaactcatctggatacggc
atgtttacgggagggttgggattccaatacggggcagagcgcctgggaatgcttaccgta
cccgcagccgcagggaataccaaacgccagattaagtttattacagacttcgggacaacc
gctttgcatgctattccgagttatgcgggacggctttatgaagtgatggaagaaatgggg
attgacccgcgccgtgacacaaaacttcgcacgttgattatcggagccgaaccgcattcg
gacgagcagcgcaggcgcattgaggatatgctgggagtgaaagcgtataattcgttcggc
atgtcggaaatgtgcggtccgggtgtggcttttgaatgccctgaacaaaatgggctgcac
atctgggaagactattacattgtagaaatcgttaaccccgatacgctggagcctgtgccc
gaaggggaaatcggagaattggtattgactaccattaaccgtgaagcaatgcctttgttg
cgctatcgtacacgtgacttgacccgcatcttgccgggtgattgtccttgcggacgccat
cacaaacggttggaccgcatgaagggacgaagcgacgatatgatgatactgaaaggcgtg
aatattttccccatccagatagaaaacatcttaatgcaattcaaggaattgggtaacgag
taccttatcaccctaaccaatttagaggcgaatgatgaaatgaccgtggaagtggaactt
aacgactttaccgatgactacggtttcttgcaacgcctgacaaaggaaataacccgtcag
ctaaaagacgaaatacttatcactccgcgtgtgaaacttgtgcccaaaggaagcctgccc
aaacaggaaggcaaggccgtgcgcgtaaaagatttaagaaaaacattaatataa

DBGET integrated database retrieval system