KEGG   Bacteroides salanitronis: Bacsa_1083Help
Entry
Bacsa_1083        CDS       T01433                                 

Definition
(GenBank) hypothetical protein
Organism
bsa  Bacteroides salanitronis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE TRAM_LAG1_CLN8
Motif
Other DBs
NCBI-ProteinID: ADY35671
UniProt: F0R4V7
Position
1234874..1236034
Genome map
AA seq 386 aa AA seqDB search
MAGNQNKRGSYPLVNWADGMPVKKEHFVQQENHFTHRLCEYQSYHLNRTNYGLLPFKKGE
PVSGDFSITELVTGTLEVRLKRCYAITSGGYLIDYDAGDNDELTASFHISADEMEDKALR
WDVILMADPFEHRPSGVPDEKELSPRQPNALPKYALSVLPTGQTNGGELGRHFLLIGRLR
KNGNRCEVDGNFIPPCTSMSSHPDLKNYYTKFGQLVDSIEKASFDILAKVENAEKQTALA
TNIGMLCRHIMLFISDIYFSYRNEGQYYSPLRFLNVFSTLAHHLYVCLSFMSKEEKEDLL
KYFNEWNGITPGAYEGLLRENCGLLYDHHNIRQLMVTTERFLYLFNDLWTTLSRLEYIGK
HKENIVVAERSRHPKESSETRWNILD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaatcaaaataaaaggggcagctatccgcttgtgaactgggcggacggcatg
ccggtcaagaaggaacacttcgtccagcaggaaaaccattttacgcaccggctgtgcgaa
taccagtcgtatcatctgaaccgcaccaactacgggcttttacccttcaagaagggggaa
cccgtttccggagatttcagcatcacggaacttgtcacgggaactttggaagtccgtctg
aaacggtgctatgccattacttccggaggatacctgattgattatgacgcaggagacaat
gatgaactgacggccagtttccatatttctgccgatgaaatggaagacaaagccctgcga
tgggacgtcatcctgatggctgatccgttcgagcaccgtccttcaggtgtcccggatgaa
aaggaattaagtccgcggcaacccaacgcattgcctaaatatgcgttgagcgtactgcca
acagggcaaaccaacggaggcgagctaggcaggcacttcctgctgatcggtcgtttgcgc
aagaacggcaaccgctgcgaagtggacggtaacttcatacctccctgtaccagcatgtcc
agccatcctgacctgaagaactattacaccaaattcgggcagcttgtcgattccatcgaa
aaagcctcattcgatattctcgccaaggtggaaaatgcggaaaagcaaacggcactggcc
acaaacatcggcatgttgtgccgccatatcatgcttttcatatccgacatttatttttcc
taccgtaatgaaggacaatactattcccccttgcgttttctgaatgtattctccacactg
gcccaccacctgtacgtatgcctgagtttcatgagcaaggaggagaaagaagatctgttg
aaatacttcaatgaatggaacggcatcactcccggcgcatacgaagggctgttgcgggaa
aattgcggcttgctgtatgaccatcacaatatccgccaactgatggtaacaacagagcgt
ttcctatacctgttcaatgacttgtggaccaccctcagccgccttgaatacattggcaag
cacaaggagaacatcgtggttgccgaacgctccagacaccccaaggaatccagcgagaca
cgttggaacatattggactaa

DBGET integrated database retrieval system