KEGG   Bacteroides salanitronis: Bacsa_2492Help
Entry
Bacsa_2492        CDS       T01433                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00790  Folate biosynthesis
bsa01100  Metabolic pathways
Module
bsa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bacsa_2492
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bacsa_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADY37031
UniProt: F0R868
Position
2898554..2899141
Genome map
AA seq 195 aa AA seqDB search
MIDTDLLKFPEEKVQKLMAHYKEILALLGEDTGREGLLKTPERVAKAMLTLTRGYDVDPK
EILLGAKFKEEYSQMVVVKDIDFFSMCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDV
FSHRLQVQERMTLQIKECIQETLHPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAF
NQAKTREEFMNLIRK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgattgatacagacttgttgaagttcccggaagagaaagtgcagaagctgatggcgcat
tacaaagagattcttgcgcttttgggcgaagacaccggacgggaaggattgttgaagact
ccggagcgtgtggcaaaagccatgctcacgcttacaaggggatatgatgtagacccgaaa
gagattttattgggtgctaaattcaaggaagaatatagccagatggtcgtagtaaaggat
atcgatttcttctcgatgtgcgagcatcacatgttgcccttttatgggaaagcgcacgtg
gcgtatatcccgaacggatacatcacggggctgagcaagatagcccgtgtggtggatgta
ttctcgcaccgccttcaggtgcaggagcgcatgaccttgcaaatcaaagaatgcattcag
gaaacgctgcacccattaggcgtaatggtcgtagtagaagccaaacacatgtgcatgcag
atgcggggcgtggagaagcagaactccatcaccactacttccgactttaccggagctttc
aatcaagccaagacaagagaggaattcatgaacctgattcggaaataa

DBGET integrated database retrieval system