KEGG   Bacillus safensis: BSL056_06845Help
Entry
BSL056_06845      CDS       T05386                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00300  Lysine biosynthesis
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
bsaf01230  Biosynthesis of amino acids
Module
bsaf_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSL056_06845
Enzymes [BR:bsaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     BSL056_06845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: APJ10685
UniProt: A0A0M2EED8
Position
1371277..1371987
Genome map
AA seq 236 aa AA seqDB search
MKQMDANEIISFIQNSTKSTPVKVYIKGDLEGIEFGEHAKTFITGNTGVVFGEWSEIQEA
LASNKDKIEDVVVENDRRNSAIPMLDLKNIKARIEPGAIIRDQVEIGDNAVIMMGASINI
GSVIGEGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVIEPPSAKPVVVEDDVVIGANAVV
LEGVTIGKGAVVAAGAIVVNDVEPYTVVAGTPAKKIKDIDEKTKGKTEIKQELRQL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatggacgctaatgaaattatttcatttattcaaaatagtacaaaatcaaca
cctgtcaaagtctatatcaaaggtgacttagaaggtattgagtttggtgaacatgcaaaa
acattcatcacaggaaacactggagttgttttcggtgagtggagcgaaattcaagaagcg
ctagcatctaacaaagataaaattgaagatgttgtcgtggaaaatgaccgccgcaactct
gcaattccgatgttagatttgaaaaacattaaagcccgtattgagccaggggcaatcatt
cgtgaccaagttgaaatcggtgataatgcagtcattatgatgggtgcttctattaatatc
ggttctgtgatcggcgaaggtacgatgattgacatgaacgtggtgcttggcggccgtgcg
acagtaggtaagaactgtcatatcggtgctggatctgttcttgcaggtgtcattgagccg
ccttctgctaaaccagttgttgtagaagatgacgttgtcatcggtgcgaacgctgttgtt
ctagaaggcgtgacaattggtaaaggtgcagtagtagcggctggtgcaatcgttgtaaac
gatgtagagccttacacagttgtagcaggtacacctgctaagaaaatcaaagacattgat
gagaaaacaaaaggtaagactgaaatcaaacaagaactgcgtcagctttaa

DBGET integrated database retrieval system