KEGG   Bacillus safensis: BSL056_10760Help
Entry
BSL056_10760      CDS       T05386                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00670  One carbon pool by folate
bsaf00790  Folate biosynthesis
bsaf01100  Metabolic pathways
Module
bsaf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSL056_10760
   00670 One carbon pool by folate
    BSL056_10760
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BSL056_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: APJ11408
Position
complement(2107412..2107897)
Genome map
AA seq 161 aa AA seqDB search
MISMIVATGKDRVIGQDNQMPWHLPADLAYFKKVTGGHTIVMGRKTFESIGRALPNRRNI
VLTTSSSFKAEGCEVVHSIADILAIAESEAELFIIGGSKLYEEMMPYADRLYITHIHHAF
EGDRYFPYYNEDEWTIVSREKGHCDEKNPYNYEFVVYDKKG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatttccatgattgtggcgacaggtaaagatagagtcattggtcaagataatcaaatg
ccttggcatttaccagcagatttagcgtattttaaaaaagtcacaggcggtcatacgatt
gtcatgggcagaaaaacctttgaatcgattggacgagcactgcctaatcgccgaaacatt
gtgctgaccacaagttcttcttttaaagcagaaggatgcgaggttgttcattcaattgct
gacattttggcaattgcggaaagtgaggcagagctctttatcattggcgggtctaaactg
tatgaagaaatgatgccatatgcggatcgtctctatatcacgcacattcaccatgcgttt
gaaggagaccgctatttcccgtattacaatgaagatgaatggacgattgtatcacgcgaa
aaaggccattgtgacgaaaagaacccctacaattatgaatttgtcgtctatgacaaaaaa
ggataa

DBGET integrated database retrieval system