KEGG   Bacillus safensis: BSL056_10815Help
Entry
BSL056_10815      CDS       T05386                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00270  Cysteine and methionine metabolism
bsaf00920  Sulfur metabolism
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
bsaf01130  Biosynthesis of antibiotics
bsaf01230  Biosynthesis of amino acids
Module
bsaf_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSL056_10815
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSL056_10815
Enzymes [BR:bsaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BSL056_10815
    2.3.1.46  homoserine O-succinyltransferase
     BSL056_10815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase
Motif
Other DBs
NCBI-ProteinID: APJ11419
UniProt: A0A494TIR5
Position
2117780..2118688
Genome map
AA seq 302 aa AA seqDB search
MPINIPVHLPAKQILESENIFVMDETRAFKQDIRPLNIVILNLMPKKIQTETQLLRMLGN
SPLQVYFTFLIPSTHTPKNTSREHLDEFYTTFESIRHKKFDGMIITGAPIEHLPFEEVSY
WKELQDILDWSKTNVTSTLHICWGAQAGLYHHYGIEKIKLPEKKFGVFEHIVKEKKERLV
RGFDEVYYVPHSRHTDINTEQLKNTPNLKVLSMSEEAGVCLIVSDDDKQVFLTGHPEYDT
DTLMQEYERDLLKHDTVQKPVHYFIEDGDTLIPVNRWKAHATLLFMNWLNYYVYQETPYV
WE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgcctattaacataccagttcatctgccggcaaaacaaatactagagagcgaaaatatt
ttcgtcatggatgagacaagggcattcaagcaagatatccgtcctttgaatatcgtgatc
ttaaatttaatgccaaaaaaaatacaaactgaaacgcagctgctgagaatgctcggaaat
tctcctttacaagtgtactttacgtttttgattccgagtacacatacaccgaagaatacg
tcgagagagcatctagatgaattttatacgacctttgaatcgattcgccataaaaaattt
gatggaatgatcatcactggcgcaccaatcgagcacttaccttttgaagaagtctcttat
tggaaagagctgcaggacattttggactggagtaaaaccaatgtgacgtctacccttcat
atttgctggggtgcacaggcaggtttatatcaccattacgggattgaaaaaatcaagctt
cccgagaaaaaatttggcgtatttgagcatattgtgaaagagaaaaaagaaagattagtc
agaggttttgatgaagtatactatgtcccacattctaggcatacagatattaatacagaa
caattaaaaaacacgccgaatttgaaagtcttgagtatgtctgaagaagcgggtgtttgt
ttaattgtttcagatgatgataaacaagtatttttaactggacatcctgaatatgataca
gatacattgatgcaggaatatgaaagagatttgttgaaacatgatacagtccaaaaacct
gtccactattttatagaagatggtgacacattaatcccagtaaatcgctggaaagcccat
gcaaccttattgtttatgaattggcttaattattatgtttatcaagaaacaccatacgtt
tgggaataa

DBGET integrated database retrieval system