KEGG   Bacillus safensis: BSL056_13115Help
Entry
BSL056_13115      CDS       T05386                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsaf  Bacillus safensis
Pathway
bsaf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSL056_13115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsaf03400]
    BSL056_13115
Enzymes [BR:bsaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BSL056_13115
DNA repair and recombination proteins [BR:bsaf03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSL056_13115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 AAA_12 UvrD_C AAA_16 AAA_22 T2SSE AAA NTPase_1 Zeta_toxin TsaE UvrD-helicase AAA_18 AAA_28 ABC_tran AAA_17 CbiA
Motif
Other DBs
NCBI-ProteinID: APJ11844
Position
complement(2523924..2526308)
Genome map
AA seq 794 aa AA seqDB search
MQEHPDQMKLEDEPFLKGTIQAVIFHNESNLYSVLKVKVIETSENLEEKTASVTGYFPAL
HEEETYTFYGKVTSHPKFGEQFQATHFQKEVPTTKQGIIHYLSSDLFEGIGKKTAEEIVG
QLGNQTLHKIMRDPAVLYDVPRLSKKKADKLAAALQEHQGLEQIMISLNQYGFGPQLSMK
IYQVYESETLQKIEENPYQLVKDVEGIGFIKADELGARTGISGNDPERIRAALLYTVETA
SLQDGHTYIQTKDLIVETRKLLNQTGNDYKVTEMDVANQIIALGEGKEMIIEDDRCYHPS
LFYAEQSVAKRIQKIVSQTEYADQFPESEFLLALGELEERLGVQYAPTQKEAIQKALMSP
MLLLTGGPGTGKTTVIKGIVELYSDLHGVSLDPSDYKKDESFPFVLAAPTGRAAKRMTES
TGLPAVTIHRLLGWNGSEGFSHDEEQPIEGKLVIIDESSMLDIWLANHLFKAIPDHIQVI
MVGDEHQLPSVGPGQVLRDLLASKAVPAVTLTDIYRQADGSTIVELAHDMKNGVLPKDIT
ARSKDRSFIQCSADQMKEVIEKVVSNAAQKGFSAKDIQVLAPMYKGKAGINELNKMLQHI
LNPKKPKGREIPFGDVVYRTGDKVLQLVNQPENNIFNGDIGEIVSIFYAKENTEKEDMAV
ISFDGNEITFTKKDFHQFTHAYCCSIHKSQGSEFPIVVLPVVRSYYRMLRRNLLYTAITR
SKKFLILCGEESALEWGVKNNEDSLRQTSLTMRLVQTEQIMDAELEALQKELPFSVHDAN
IGMEGITPFDFMHE
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaacatccagatcaaatgaagcttgaggacgaaccatttttaaaggggaccatt
caagccgttattttccataatgaaagtaatttatactcggtgttaaaggtaaaagtcatt
gaaacatcggaaaacttagaggaaaaaacagcatctgtcacaggctacttcccagcactt
catgaggaggaaacctacaccttttatggcaaagtcacgagccatccgaaatttggtgaa
cagtttcaggccactcattttcaaaaggaagtaccgacaacgaagcaaggcatcatacat
tatctctcaagtgatttatttgaagggatagggaaaaagacggcggaagaaatcgtgggg
cagcttggcaatcagacgcttcataaaattatgcgtgacccagctgttttgtatgatgta
ccgcgcttatcaaaaaagaaggcggataagctggccgcagcgcttcaggagcatcaaggg
ctggaacaaatcatgatcagcctgaatcagtatggctttggtccgcagctcagcatgaag
atttaccaagtatacgagagtgaaacgctgcagaaaatcgaggaaaatccctatcagctc
gttaaggatgttgaggggatcgggtttattaaggcggatgagcttggcgctagaacaggc
atctcaggaaatgacccagaacggattcgcgccgccttgctatatacagtggagacagcc
agtctacaggacggtcatacgtacatacaaacgaaagatttgatcgtcgaaacccgcaag
ctgctcaaccaaacaggcaatgattacaaagtgactgaaatggatgttgccaatcagatc
attgcacttggcgaaggaaaagaaatgatcattgaagatgaccgctgctatcatccatcc
ttattttatgcggagcaaagtgtcgccaaacgcattcaaaaaatcgtctcccaaacagaa
tatgcagatcaatttcctgaatcagaattcctgctagcacttggcgagttggaggagcgg
ttaggcgttcaatatgcaccgacacaaaaggaagcgattcaaaaggcactcatgtccccg
atgctgcttttaacaggcgggcctggaacagggaagacgacggtcattaaaggaattgtc
gagctttacagtgatcttcacggtgtttctcttgatccgagtgattataaaaaagatgaa
tccttcccatttgtgcttgcggcaccaactggacgggcggctaaacggatgacagaatca
acagggcttccagctgtcaccattcaccggctgctaggctggaatggttcggagggcttc
tctcatgatgaggaacagccgattgaaggaaagcttgtcatcattgatgaatcaagtatg
ctggatatttggctggcgaatcatttgtttaaagcgattcctgatcatatccaagtgatt
atggtaggggatgaacatcagctgccatctgtcggaccaggccaagttttacgggatttg
cttgcctcaaaagccgtgccggctgttaccctgacagatatttaccggcaggcagacggc
tcaaccattgttgaacttgcacatgatatgaaaaatggtgtgctgccaaaggatatcact
gcacgctcaaaggatcggtccttcattcagtgttcagctgatcaaatgaaagaagtcatt
gagaaagttgtcagcaatgctgctcaaaaagggttttcggcaaaggatattcaagtgctg
gcaccgatgtataaaggaaaagcaggcatcaatgagctcaataaaatgctgcagcacatt
ttgaatcctaaaaaaccaaagggaagggaaatcccgtttggtgatgtggtgtaccggaca
ggtgataaggtgcttcagcttgtgaatcagccggagaacaacatttttaacggcgatatc
ggtgaaattgtctcgattttttatgcaaaagaaaatacagaaaaagaagacatggctgtg
atctcttttgatggaaatgaaatcacctttacaaaaaaagattttcatcaatttacacat
gcttattgctgctctattcacaaatcacaaggaagtgaattcccgattgttgtgctgcca
gtcgtcaggagctactaccgaatgcttcggcggaatctactgtacacagccattacacgc
agtaaaaagtttttaatactgtgcggcgaggaatcagcgctggagtggggcgtgaaaaac
aatgaggattccctcagacaaacgtccttaacgatgcggctagtgcaaaccgaacaaatt
atggatgcagaacttgaagcactccaaaaagagcttccgtttagcgtacatgacgcaaat
attggcatggagggaatcactccatttgattttatgcatgagtag

DBGET integrated database retrieval system