KEGG   Bacillus safensis: BSL056_16095Help
Entry
BSL056_16095      CDS       T05386                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K16216  benzil reductase ((S)-benzoin forming) [EC:1.1.1.320]
Organism
bsaf  Bacillus safensis
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSL056_16095
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.320  benzil reductase [(S)-benzoin forming]
     BSL056_16095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 NAD_binding_10 Epimerase KR DUF4781
Motif
Other DBs
NCBI-ProteinID: APJ13295
Position
complement(3091160..3091903)
Genome map
AA seq 247 aa AA seqDB search
MRISIVTGGSKGFGLALINRLLSRGDHVYTAARSASPISHPKLTHTQVDLTDEEAAAKWL
QHSLTPQTLADADDILLVNNAGMVTPIKRVGQGGQDTLHQHYKLNLVIPVLLSHVFAKQT
QSFNGKKTIVHLSSGAAKNPYKGWSAYCSSKAGLDMFMRTFHEEQQDEAHPINTFSFSPG
TIDTDMQGEIRKSSKQDFEQIDRFQQLYETGTLKSPDEVARILLDLLSGDPAGGCVYDAR
EYGKKQS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
attcgaatttcaatcgttacaggcggatcaaaaggttttggcttagcacttataaacagg
ctgctttcacgcggggatcatgtgtacacggcagcaagaagtgcatcgccaatatcccat
ccgaagcttacacatacccaggttgatctgaccgatgaagaagcagcggccaaatggctt
caacatagtcttacgccgcaaactctggcagatgctgatgacatcttacttgtcaacaat
gcaggaatggtcacaccgatcaagcgcgttggacaaggcggacaggatacacttcatcag
cattacaagctgaatcttgtcattcctgttttgctgagccatgtgtttgccaagcagact
caatcatttaacggaaagaaaacgatcgttcatctctcttctggagcggcgaaaaaccca
tacaaaggctggagtgcgtattgcagttcaaaggcaggactcgatatgtttatgaggact
tttcatgaggaacaacaggacgaggcgcatccgatcaacacgttttccttttcacccggc
acgatcgatacagatatgcagggggaaattcggaaatcatcaaaacaagactttgaacaa
atagaccgttttcagcaattatatgaaacaggcacgttaaagagcccagatgaagtcgca
cgtattttgctcgatcttttatcgggtgatccagctggcggatgtgtctacgatgcacgt
gagtatgggaaaaagcagtcataa

DBGET integrated database retrieval system