KEGG   Bacillus safensis: BSL056_19450Help
Entry
BSL056_19450      CDS       T05386                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00730  Thiamine metabolism
bsaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSL056_19450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsaf03000]
    BSL056_19450
Enzymes [BR:bsaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BSL056_19450
Transcription factors [BR:bsaf03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSL056_19450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: APJ12998
Position
complement(3756030..3756716)
Genome map
AA seq 228 aa AA seqDB search
MTFSTQLRKEAEPLFEAIYQHPFVRGLAAGKLEKEQIIHYVKQDAEYLQAFIKIYAAALS
RCTDREDIAFFHQQIAFVLDSETHPHQNLCRVAGVAYDELQGASLAPSAHHYIHHMLQVA
QEGTLGEIIAVLLPCPWTYWEIGKRMLTDVQPDPSHPFYEWITFYGGLTDSVTGELCKRL
DQLAEAASEKEKEKMKQHFILSCQLEYKFWEMAFTVEEWPVQLEVHSS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacattttctacgcaattaaggaaagaagcagaaccgttatttgaagccatttatcag
catccgttcgtcagaggcctggcagcaggaaagctggaaaaggaacaaatcattcattac
gtcaaacaagatgcagaatacttacaagcattcattaaaatttatgcagcagcgctcagc
agatgtacagacagggaggatattgcgtttttccatcagcagattgcgtttgtactagat
agtgagacgcaccctcatcaaaacctttgccgagtggcaggggtagcatatgatgagctc
caaggtgcttctttggctccgagtgctcaccactatattcatcacatgctgcaagttgcg
caagaaggtacgcttggtgaaatcatcgctgtcctgcttccatgtccttggacatattgg
gagatagggaaacgaatgctcacagatgtgcagccagacccttcacatccgttttatgag
tggatcacgttttatggaggattaactgattctgttacaggtgagctttgcaagcggctc
gatcagttggcggaagcagcaagtgagaaggaaaaggaaaaaatgaaacagcactttatc
ttaagctgccagctcgagtacaagttttgggaaatggccttcactgttgaagagtggcca
gttcaactggaggtgcattcatcatga

DBGET integrated database retrieval system