KEGG   Bacterioplanes sanyensis: CHH28_01210Help
Entry
CHH28_01210       CDS       T04982                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsan  Bacterioplanes sanyensis
Pathway
bsan00730  Thiamine metabolism
bsan00790  Folate biosynthesis
bsan01100  Metabolic pathways
bsan02020  Two-component system
Module
bsan_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CHH28_01210
   00790 Folate biosynthesis
    CHH28_01210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHH28_01210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsan04147]
    CHH28_01210
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsan00537]
    CHH28_01210
Enzymes [BR:bsan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CHH28_01210
Exosome [BR:bsan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHH28_01210
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsan00537]
 Enzymes
  CHH28_01210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ASP40784
UniProt: A0A222FQI4
Position
complement(257197..258903)
Genome map
AA seq 568 aa AA seqDB search
MKTLTKLSAAMLTSATLAASTLLIACGSDSDSSSDAPAVSQSGQVKNLILMIGDGMGAQQ
VGLLEEYARRSPANAAQVGQVTGLQRLAEGGALGLSMTAPMGANAGLVVDSACSATQLAT
GQGSISEAVGLDDQGNKVETILEKAQKMGKATGLITDTRLTHATPAGFASHRPHRSMENE
IAEDLLDAGVDVLLGGGSRHWAPKVDDFDALAAELNAPTHVIKKSKRSADDERNLFAEAK
NAGYALAFDREQMNAVTSGKLLGLFDDSAMNDGIEYTQCKKAGSADAGSKCADEPSLKEM
TKKALDILSQDPDGFFLMVEGGQIDWAGHINDTGWLLHEMLKFDEAVQAVYEWAAERDDT
LVVVTADHETGGFGMAYHKHDIPEAKTLPGDGMVNGDGSARDYQPQYNFGALATLDKIYA
QERSFYDILSAVNGDWDFSNTQATDWVAAVNASLHQDFHIDAESGERIAARYEVPAEDVH
PEHKYLSATNIPKFNDFSDFYVYADEDTGALIAREIAPKQSVTWGNGTHTAAPVPVYAFG
PEAITKQFSTMQHHTDVGQKMIKALIGE
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctcaccaaattatcagcagccatgttgacgtcggcgaccttagcagcgtcg
accttgctgattgcttgtggcagtgattccgactccagctcagacgcaccggccgtgagt
cagtcaggtcaggtgaagaatctgattttaatgattggcgatggtatgggcgctcagcag
gtagggctgttggaagagtatgcgcgccgctcgcccgccaatgccgcacaagttggtcag
gtcactggcttacagcgtttggcggaaggcggtgctttgggtttatcgatgactgccccg
atgggcgccaacgccggtttggtggtggactccgcttgctcggccacccagttagcaact
ggccaggggtctatttccgaagccgtgggtttggacgatcagggcaataaagtcgaaacc
attttggaaaaagcgcaaaaaatgggtaaggctaccggcctgattaccgatacgcgctta
acccatgccacgccggcagggtttgcctcacatcgtccacatcggtcgatggaaaatgaa
atcgctgaagacttattagatgccggcgtggatgttttgttgggtggtggttcgcgccat
tgggcacctaaggtggatgattttgatgcacttgcggcagaattgaatgctccgactcac
gtgattaaaaagtccaagcgcagcgccgatgatgagcgcaacttatttgctgaagccaaa
aacgcagggtatgccctggcgttcgatcgtgagcaaatgaatgcggtgacgtcaggcaag
ctgttggggttatttgacgattcggcgatgaacgatggtattgaatacacccagtgcaaa
aaagctggctcggcagacgcgggcagcaaatgcgctgatgagccatcgctgaaagaaatg
accaaaaaagcgttggatattctgtcacaagatccagatggcttctttctgatggttgaa
ggcggtcaaatcgattgggcgggtcatatcaacgacaccggctggttattgcatgaaatg
ctgaagtttgatgaagcagtgcaggccgtatacgaatgggctgcagaacgtgacgatact
ttggtggtggtgacggctgaccatgaaaccggtggttttggtatggcgtatcacaagcac
gatatccctgaggcgaaaaccttgccgggcgacggcatggtgaatggcgatggcagtgcg
cgtgattatcagccgcagtataactttggcgcgctggcaacgctggacaaaatttacgca
caagaacgctcgttctacgacattcttagcgctgtgaatggcgactgggatttctcaaat
acccaggcaacggattgggtagctgcggtgaatgccagcctgcatcaggattttcacatt
gatgccgaatcgggcgagcgcattgcggcgcgctatgaagtgccagccgaagatgtgcac
cctgagcacaaatatctgagtgcgaccaatatcccgaaatttaacgatttttcagacttc
tatgtgtatgccgatgaagacaccggtgctttgattgcgcgtgaaattgcgcctaagcaa
agcgtgacctggggcaatggcacccataccgcagcacctgtgcctgtgtatgcctttggt
ccagaggccattactaagcagttttctaccatgcagcatcacactgatgtcggtcagaaa
atgattaaggcactgatcggcgagtaa

DBGET integrated database retrieval system