KEGG   Bacterioplanes sanyensis: CHH28_07755Help
Entry
CHH28_07755       CDS       T04982                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsan  Bacterioplanes sanyensis
Pathway
bsan00071  Fatty acid degradation
bsan00072  Synthesis and degradation of ketone bodies
bsan00280  Valine, leucine and isoleucine degradation
bsan00310  Lysine degradation
bsan00362  Benzoate degradation
bsan00380  Tryptophan metabolism
bsan00620  Pyruvate metabolism
bsan00630  Glyoxylate and dicarboxylate metabolism
bsan00640  Propanoate metabolism
bsan00650  Butanoate metabolism
bsan00900  Terpenoid backbone biosynthesis
bsan01100  Metabolic pathways
bsan01110  Biosynthesis of secondary metabolites
bsan01120  Microbial metabolism in diverse environments
bsan01130  Biosynthesis of antibiotics
bsan01200  Carbon metabolism
bsan01212  Fatty acid metabolism
bsan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHH28_07755
   00630 Glyoxylate and dicarboxylate metabolism
    CHH28_07755
   00640 Propanoate metabolism
    CHH28_07755
   00650 Butanoate metabolism
    CHH28_07755
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHH28_07755
   00072 Synthesis and degradation of ketone bodies
    CHH28_07755
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHH28_07755
   00310 Lysine degradation
    CHH28_07755
   00380 Tryptophan metabolism
    CHH28_07755
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHH28_07755
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHH28_07755
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHH28_07755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsan04147]
    CHH28_07755
Enzymes [BR:bsan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHH28_07755
Exosome [BR:bsan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHH28_07755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASP40864
UniProt: A0A222FQS8
Position
complement(1619300..1620487)
Genome map
AA seq 395 aa AA seqDB search
MSNQDAVVIVAGARTPMGGFQGSLASVPATDLGAIAIAEVVKRAGIDAADVQEVIVGNVL
PAGLKQGPARQAMRKAGLPDATGATTINKLCGSGMKAAMMAHDAIKAGSVEVAIAGGMES
MSNAPYILENARTGYRMGHASAPKDHMFFDGLEDAETGKLMGAFAQDMADQKGYTREQMD
EYAIRSLTRAKDAIEKGLNSAEIVPVTVSTRKGDTLVEQDEQPFNANIEKIPSLRPAFKK
DGTVTAANASSISDGASALLLMSESAAKAKGLQPLARIVAHSTQSQHPSEFTCAPVGAIK
TLLEKTGWSTSDVDLYEINEAFAMVAMMPIDELGLDADKVNIYGGACAQGHPVGSTGSRL
LVTLMNALKNTGGQKGVAALCIGGGEATAMAIELL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcaagacgcagtggtcattgtggccggcgcacggacgccaatgggtggcttt
caaggcagtctggccagtgtgccagcgaccgacttgggcgccattgccatcgccgaggtg
gtaaagcgcgccggtattgatgccgccgacgtgcaagaagtcattgttggcaacgtacta
ccggcaggcctgaaacaaggcccagcgcgacaagccatgcgcaaagcaggtttaccggac
gccaccggcgccaccaccatcaacaagttgtgcggctctggtatgaaagcggcgatgatg
gcgcacgatgccatcaaggctggctcggtcgaagtcgccattgccggtggcatggagtcc
atgtctaacgccccttatattttggaaaacgcacgcacaggctaccgcatgggccatgct
tcggcgccgaaggaccacatgttcttcgatggcctggaagatgccgaaaccggcaagctg
atgggtgcgtttgcgcaagacatggccgatcagaaaggctacacccgtgagcaaatggac
gaatacgccatccgttcactgacacgcgctaaagatgccattgaaaaaggcctgaacagc
gctgaaatcgtgccggtaacggtatccacgcgcaaaggcgataccttggttgagcaagat
gagcagccgttcaacgctaatatcgaaaaaattccatctctgcgcccggcgttcaaaaaa
gacggcaccgtgaccgcggctaacgcttcgtctatctctgacggcgcctcagccttgctg
ctgatgagcgaaagtgctgccaaggccaaaggtctgcagccgttagcgcgcatcgtcgcg
cacagcacacagtcacagcaccccagtgagttcacctgtgcgcctgtcggtgccattaag
acactgctggagaaaaccggctggagcaccagtgacgttgacctgtacgaaatcaatgaa
gcctttgccatggtcgccatgatgccgatcgatgaactgggcttagacgctgacaaggtc
aatatttatggcggtgcctgcgctcagggccaccctgtgggctccaccggctcacgcctg
ctggtcaccttgatgaacgcgctgaaaaacaccggcggtcaaaaaggcgtagctgccttg
tgtattggcggcggcgaggccaccgcaatggccatcgagctgctgtaa

DBGET integrated database retrieval system