KEGG   Bacterioplanes sanyensis: CHH28_10035Help
Entry
CHH28_10035       CDS       T04982                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bsan  Bacterioplanes sanyensis
Pathway
bsan00790  Folate biosynthesis
bsan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHH28_10035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsan04147]
    CHH28_10035
Enzymes [BR:bsan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CHH28_10035
Exosome [BR:bsan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHH28_10035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF155
Motif
Other DBs
NCBI-ProteinID: ASP38995
UniProt: A0A222FIX9
Position
complement(2136318..2136599)
Genome map
AA seq 93 aa AA seqDB search
MANLTEIPAALAASGWQLSTDKQSIHKVFKFADFRDAMSFMVRVSYEAEAADHHPEWLNV
YNRVETTLTTHDTGGLTQKDIDLAEAMDKISER
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcttaccgagattcctgcagcgctggcagccagcggctggcagttgtccaca
gataaacagtccattcacaaagtgtttaaatttgccgattttcgcgatgccatgagcttt
atggtgcgtgtatcgtatgaggcagaagccgccgaccatcacccagaatggctgaatgtg
tacaaccgagtggaaaccaccttaacaacccacgataccggcggcctcacccaaaaggat
atcgatctggctgaagccatggataagatttccgagcggtag

DBGET integrated database retrieval system