KEGG   Bacterioplanes sanyensis: CHH28_18080Help
Entry
CHH28_18080       CDS       T04982                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
bsan  Bacterioplanes sanyensis
Pathway
bsan00010  Glycolysis / Gluconeogenesis
bsan01100  Metabolic pathways
bsan01110  Biosynthesis of secondary metabolites
bsan01120  Microbial metabolism in diverse environments
bsan01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHH28_18080
Enzymes [BR:bsan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CHH28_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ASP40466
UniProt: A0A222FPL3
Position
3938959..3939837
Genome map
AA seq 292 aa AA seqDB search
MNLQRSTFCRPIRRQQLDIIGIQHPLFSAELALQGAQLLNFQPQGDPPWLWLSEQADYLQ
GSSVRGGIPVCWPWFGDLRRNPQAVQQHFQGNGSSAPAHGLARTALWQLSALKEDVHQVD
LTLATQQLSRLWPTMSAQLHITLRRDRLVLRLNSRNDSPNPVTISQALHTYLPVEDIRTV
TVGGLQGNTYIDALDDWQSRQQQGLVRFSAETDRIYHSQGPLRLQSGQHSRTLVSNSAST
VVWNPWINKSQRLSQFHPDAWQRMVCIETTNAAFDCVALQPGQQHSLQLQLT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcagcgcagcaccttttgtcgcccaatacgccgccagcagctggacattatc
ggcatccagcatcctttgttttcagcagaactggcgctgcaaggtgcgcagttgctgaac
ttccagccccaaggggatcccccctggctatggctaagcgagcaggcggactaccttcag
ggcagctcggtgcgtggcggcattcccgtttgttggccctggtttggtgacttacggcgc
aacccacaggctgtgcaacagcatttccaggggaacggcagttcagctccagcacacggt
ttagcacgcacggccttgtggcagttgagcgcgctgaaagaagacgtgcaccaagtcgat
ctgaccttggccacacaacagctcagccgtttatggcccaccatgtctgcacaactgcac
atcaccctgcgccgcgaccgcttggttttacgccttaacagccgcaatgacagcccgaat
ccggtgactatcagccaggccctgcacacctacttgccggtggaggacattcgcacagtg
acagtcggcgggctgcaagggaatacctacatcgatgcactggatgattggcaatcccgc
caacaacaggggctagttagattcagcgcggagacggatcgcatctaccacagccaaggg
cctttacgcctgcaatccggtcagcacagccgcaccttggtgagcaacagtgccagtacg
gtggtgtggaacccttggatcaataaaagccaacgcttgagtcagtttcaccccgatgct
tggcaacgcatggtgtgcatcgaaaccaccaacgccgcctttgattgcgttgcgctacag
cctggccagcagcacagcttgcagctacagctaacctga

DBGET integrated database retrieval system