KEGG   Brachybacterium saurashtrense: DWV08_05335Help
Entry
DWV08_05335       CDS       T05573                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bsau  Brachybacterium saurashtrense
Pathway
bsau00790  Folate biosynthesis
bsau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DWV08_05335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsau04147]
    DWV08_05335
Enzymes [BR:bsau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     DWV08_05335
Exosome [BR:bsau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DWV08_05335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_6 Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AXK45096
UniProt: A0A345YME4
Position
1174527..1175153
Genome map
AA seq 208 aa AA seqDB search
MDILRGDEIAAAHLSDWRKLAQGLHARFLLDDFAAGAQFLAAVADAGASLAHHPRVSLVA
DAVDLTLISQDAVYREADGTEHVVAWVTQIELGLDAADSARIAPVWAQLLTGSAEAQGHG
SPSDEIRDVRGRVPNLWFGDRAEGDAPGTRLHLEIYLAPEVVRARIDAAVAAGAEIVDDS
DSPGLTVLADQEGNRAVICADVSAATGL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacatcctcaggggcgacgagatcgccgcggctcatctcagcgactggcgcaagctc
gcccagggactgcacgcgcgcttcctgctcgacgacttcgccgccggcgcccagttcctc
gcggccgtcgccgacgccggcgcgtccctggcgcatcatccacgggtctcgctcgtcgcc
gatgccgtggacctgacgctgatctcccaggacgcggtgtaccgcgaggccgacggcacg
gagcacgtcgtcgcctgggtgacgcagatcgagctcggcctggacgcggcggactccgcc
aggatcgcgcccgtgtgggcgcagctgctcaccggcagcgccgaggcgcagggtcacggc
tcgccgagcgacgagatccgcgacgtgcgcggacgggtgccgaatctctggttcggcgac
cgtgcggagggcgacgcaccggggacgcgcctccacctggagatctacctcgccccggag
gtggtgcgcgcgaggatcgacgccgcggtcgccgcgggcgccgagatcgtggacgactcc
gactcccccggcctcaccgtgctcgccgatcaggagggaaatcgcgccgtgatctgcgcg
gacgtctccgccgcgacggggctctga

DBGET integrated database retrieval system