KEGG   Brachybacterium saurashtrense: DWV08_08450Help
Entry
DWV08_08450       CDS       T05573                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsau  Brachybacterium saurashtrense
Pathway
bsau00020  Citrate cycle (TCA cycle)
bsau00480  Glutathione metabolism
bsau01100  Metabolic pathways
bsau01110  Biosynthesis of secondary metabolites
bsau01120  Microbial metabolism in diverse environments
bsau01130  Biosynthesis of antibiotics
bsau01200  Carbon metabolism
bsau01210  2-Oxocarboxylic acid metabolism
bsau01230  Biosynthesis of amino acids
Module
bsau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DWV08_08450
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DWV08_08450
Enzymes [BR:bsau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DWV08_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115
Motif
Other DBs
NCBI-ProteinID: AXK45637
UniProt: A0A345YNY5
Position
1865348..1867588
Genome map
AA seq 746 aa AA seqDB search
MARIIYTHTDEAPMLATASFLPILDAFSDTAGIEVTTRDISLAGRIVAAFSDLLPEEQRE
ADALAELGELAKTPEANIIKLPNISASVPQLKAAIAELQSQGIALPDYPESPETDQEKDV
RARYDSVKGSAVNPVLREGNSDRRAPAAVKNFAKKHPHRMGEWSADSKTSVATMGADDFR
SNEQSVVMDAEGTLSIVHVAADGAETVLKPSIPVLAGEVVDSTVMRAAALESFLRDQIAA
AKEQGVLFSLHLKATMMKVSDPILFGHAVRAFFPTLFTQYGDVLAEAGLSPNNGLGGILA
GIDALDETVREGVRAAIEQDLADGPDLAMVNSHKGITNLHVPSDVIIDASMPAMIRTAGH
MWNKDDAEQDTLAVIPDSSYAGVYAATIEDCQTHGAFDPTTMGTVPNVGLMAQKAEEYGS
HDKTFEIAADGRVEVRDAFGAVLMSHEVAAGDVFRACQAKDAPIRDWVQLAVRRSRESGM
PAVFWLDESRAHDRNLIAKVEQYLADPIDGKSTEDLDIRILSPIEATKHTLARVRAGEDT
ISVTGNVLRDYLTDLFPIMELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLIEEDY
LRWDSLGEFLALAESLRHLARTADNARAAVLADALDRATETLLNEGKSPQRKLGSIDNRG
SHFYLAMYWAQELAAQSEDAELATAFGPIAKELTDGEQTIAEELLAVQGKPADIGGYYRP
DTAKAAAVMRPSATFNRILEEISAAL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcatcatctacacccacaccgacgaggcaccgatgctggcgaccgcctcgttc
ctgccgatcctcgacgccttctccgacaccgccgggatcgaggtcaccacccgggacatc
tcgctggcgggccgcatcgtcgcggccttctccgatctcctccccgaggagcagcgcgag
gcggacgccctcgccgagctgggcgagctggcgaagacccccgaggccaacatcatcaag
ctccccaacatctccgcctcggtgccgcagctgaaggccgccatcgccgagctgcagagc
cagggcatcgccctgccggactaccccgaatccccggagaccgaccaggagaaggacgtc
cgggcccgctacgactccgtcaagggctcggccgtgaacccggtgctgcgtgagggcaac
tccgaccgccgcgcccccgccgccgtgaagaacttcgccaagaagcacccgcaccgcatg
ggcgagtggagcgcggactcgaagacctccgtggccaccatgggcgcggacgacttccgc
tccaacgagcagtccgtggtgatggacgccgagggcaccctctcgatcgtgcacgtcgcc
gccgacggcgccgagaccgtgctgaagccctcgatcccggtgctcgccggcgaggtcgtc
gactccaccgtgatgcgggcggcggcgctggagagcttcctgcgcgaccagatcgcggcg
gcgaaggagcagggcgtgctgttctccctgcacctgaaggccacgatgatgaaggtctcg
gacccgatcctcttcggccacgcggtgcgcgccttcttccccaccctgttcacccagtac
ggggacgtgctcgccgaggcggggctctcccccaacaacggcctgggcggcatcctcgcc
gggatcgacgcgctggacgagacggtgcgcgagggcgtgcgcgccgcgatcgagcaggat
ctcgccgacggccccgacctcgcgatggtgaactcccacaagggcattacgaacctccac
gtcccctccgacgtgatcatcgacgcctccatgccggcgatgatccgcaccgccgggcac
atgtggaacaaggacgacgccgagcaggacaccctcgcggtgatcccggactcctcctac
gccggcgtctacgccgcgaccatcgaggactgccagacccacggcgccttcgaccccacc
accatgggcacggtcccgaacgtgggcctgatggcgcagaaggccgaggagtacggctcg
cacgacaagaccttcgagatcgcggccgacggccgggtcgaggtgcgcgacgccttcggc
gccgtgctgatgagccacgaggtggccgccggggacgtgttccgcgcctgccaggccaag
gacgccccgatccgtgactgggtgcagctggccgtgcgccgctcgcgcgaatccgggatg
ccggcggtgttctggctggacgagtcccgcgcccacgaccgcaacctcatcgcgaaggtc
gagcagtacctggcggacccgatcgatgggaagagcacggaggacctcgacatccggatc
ctctccccgatcgaggcgacgaagcacaccctcgcccgcgtgcgcgccggcgaggacacc
atctccgtcaccggcaacgtgctgcgcgactacctcaccgacctgttcccgatcatggag
ctgggcaccagcgccaagatgctctcggtggtgccgctgatgaacggcggcggcctgttc
gagacgggcgcgggcggctccgccccgaagcacgtccagcagctcatcgaggaggactac
ctgcgctgggactccctcggcgagttcctggcgctggccgagtcgctgcgccacctggcg
cgcaccgcggacaacgcccgcgccgccgtgctcgccgacgcgctggaccgcgccaccgag
accctgctcaacgaggggaagtccccgcagcgcaagctgggctcgatcgacaaccgcggc
agccacttctacctcgcgatgtactgggcgcaggagctcgccgcgcagagcgaggacgcg
gagctggccaccgccttcggccccatcgcgaaggagctcacggacggcgagcagaccatc
gccgaggagctgctcgccgtacagggcaagccggccgacatcggcggctactaccgcccc
gatacggccaaggccgccgcggtgatgcgcccctcggcgaccttcaaccgcatcctcgag
gagatctccgcggcgctgtga

DBGET integrated database retrieval system