KEGG   Brachybacterium saurashtrense: DWV08_08485Help
Entry
DWV08_08485       CDS       T05573                                 

Definition
(GenBank) phosphoketolase family protein
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
bsau  Brachybacterium saurashtrense
Pathway
bsau00030  Pentose phosphate pathway
bsau01100  Metabolic pathways
bsau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DWV08_08485
Enzymes [BR:bsau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     DWV08_08485
    4.1.2.22  fructose-6-phosphate phosphoketolase
     DWV08_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C
Motif
Other DBs
NCBI-ProteinID: AXK45644
UniProt: A0A345YNZ2
Position
1872905..1875376
Genome map
AA seq 823 aa AA seqDB search
MSPTPAWPDAPASAPSDTDLTRLDAWWRAANYLSVGQIYLKDNPLLRKPLQREHVKPRLL
GHWGTTPGLTFLYAHANRAVVQRGLHAMYITGPGHGGPGLVASTYLEGTYSEVYPAVSED
EEGMRRLFTQFSFPGGIPSHVAPETPGSIHEGGELGYALSHAYGAMFDSPDQIAFTVVGD
GEAETGPLATSWHSNKFVNPQQDGVVLPILHLNGYKIANPTVLARIGDEELEALMRGYGH
EPLFFEGGFDDEDPLEIHRRFAEVLDTALDRIAEIKAQAAEDAAAGRETDRPAWPMIVLR
TPKGWTGPKEIDGQRTEGSWRSHQVPLTSARDTDEHLADLDAWLRSYRPEELFDEEGKLA
EEIAAAAPTGSLRMSANPSTNGGAVLTPLRLPDFREHAVDVPVPGGSVSEATKVLGTWLR
EVVRENPETFRIFGPDETASNRLQAVYEVTDKQWNAELEEHDRAEHLARAGRVMEVLSEH
QCQGWLEGYLLTGRHGMFSSYEAFIHIVDSMVNQHAKWLKVTNEIEWRRPLASLNYLLSS
HVWRQDHNGFSHQDPGFIDHMVNKKAEIVRVYLPPDANTLLSVYDHCLRSRQYVNVVVAG
KQPNPNWLSMDEAILHCTRGLGIWEWAGTERSGEEPEVVLAAAGDIPTIEVLAAAKILRE
EIPDLRVRVVNVVDLMRLQDDTEHPHGLSQRAFEGYFGTEAPVVFAYHGYPWLIHRLAYR
HDRLGRLHVRGYKEEGTTTTPFDMLMLNDTDRYHLVMDVIDRVDGLGTRYAGLRQRMVDT
RLRCRAHAYEHGEDAPEITQWRWSDEVDADLGAAAADTGGDNG
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccactcccgcatggcccgatgcacccgcctccgccccctccgacaccgacctg
acgcgactcgacgcctggtggcgcgccgcgaactacctctcggtcggtcagatctacctc
aaggacaatccgctgctgcgcaagccgctgcagcgcgagcacgtcaagccgcgactgctg
ggccactggggcaccacccccggcctcaccttcctctacgcgcacgcgaaccgcgccgtc
gtccagcgcgggctgcacgccatgtacatcaccggccccgggcacggcggtccgggcctg
gtggcgtccacctacctcgagggcacctactccgaggtgtaccccgcggtgagcgaggac
gaggaggggatgaggcgcctgttcacccagttctcgttccccggcgggatcccctcccac
gtcgccccggagacgccaggctcgatccacgagggcggggagctgggctacgccctctcc
cacgcctacggggcgatgttcgacagccccgaccagatcgcgttcaccgtggtgggcgac
ggcgaggcggagaccggaccgctggccacctcctggcactccaacaagttcgtcaacccg
cagcaggacggcgtggtgctgccgatcctgcacctgaacgggtacaagatcgccaacccc
accgtgctcgcgcgcatcggcgacgaggagctcgaggcgctgatgcgcgggtacgggcac
gagccgctgttcttcgagggcgggttcgacgacgaggacccgctggagatccaccgacgc
ttcgcggaggtgctcgacacggctctggaccgcatcgcggagatcaaggcgcaggccgcc
gaggacgccgcggccggccgggagaccgaccggccggcctggccgatgatcgtgctgcgc
accccgaagggatggaccggcccgaaggagatcgacggtcagcgcaccgaagggtcctgg
cgctcgcaccaggtgccgctcacgagcgcccgcgacaccgacgagcacctcgccgacctc
gatgcgtggctgcgctcctaccgtcccgaggagctcttcgacgaggaggggaagctcgcc
gaggagatcgccgccgccgcgccgacgggctcgctgcggatgtccgcgaacccctcgacc
aacggcggcgccgtgctcacgccgctgcgcctgccggacttccgggagcacgccgtcgac
gtgcccgtcccgggcggctcggtctccgaggcgacgaaggtgctgggcacctggctgcgg
gaggtggtgcgcgagaaccccgagaccttccggatcttcggccccgacgagacggcctcg
aaccggctccaggcggtctacgaggtcaccgacaagcagtggaacgcggagctcgaggag
cacgaccgcgccgagcacctcgcccgggcgggccgcgtcatggaggtgctctccgagcac
cagtgccagggctggctggagggctacctcctcaccggccggcacgggatgttctcctcc
tacgaggcgttcatccacatcgtcgactcgatggtcaaccagcacgcgaagtggctgaag
gtcaccaacgagatcgagtggcgccgtcccctggcctcgctgaactacctgctgagctcg
cacgtgtggcgccaggaccacaacggcttctcccatcaggacccgggcttcatcgaccac
atggtcaacaagaaggccgagatcgtgcgggtctacctgccgccggacgcgaacacgctg
ctgtccgtctacgaccactgcctgcgctcgaggcagtacgtgaacgtcgtcgtcgccggc
aagcagcccaacccgaactggctgagcatggacgaggcgatcctccactgcacccggggc
ctgggcatctgggagtgggccgggaccgagcggtccggcgaggagccggaggtggtcctc
gccgccgccggcgacatccccaccatcgaggtcctcgccgcggcgaagatcctccgcgag
gagatcccggatctgcgggtgcgggtggtgaacgtggtggacctgatgcgcctgcaggac
gacaccgagcacccgcacggtctctcgcagcgcgccttcgaggggtacttcggcacggag
gcgcccgtggtcttcgcctaccacggctacccgtggctgatccatcgcctggcgtaccgc
cacgaccggctcggtcgcctgcacgtgcgcggctacaaggaggaggggaccaccacgacc
cccttcgacatgctcatgctcaacgacaccgatcgctaccacctggtgatggacgtgatc
gaccgggtcgacgggctgggcacccgctacgcggggctgcgtcagcggatggtggacacc
cgcctgcgctgccgggcccatgcctacgagcacggggaggacgccccggagatcacccag
tggcggtggagcgacgaggtggacgcggacctcggcgcggcggcggccgacaccggcggc
gacaacggatga

DBGET integrated database retrieval system