KEGG   Brevundimonas subvibrioides: Bresu_0467Help
Entry
Bresu_0467        CDS       T01291                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00020  Citrate cycle (TCA cycle)
bsb00310  Lysine degradation
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
Module
bsb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bresu_0467
  Amino acid metabolism
   00310 Lysine degradation
    Bresu_0467
Enzymes [BR:bsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bresu_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADK99781
UniProt: D9QKF6
Position
complement(460727..461989)
Genome map
AA seq 420 aa AA seqDB search
MADILTPTLGESVSEATIAKWSKKVGDAVKKDEMLVELETDKVSLEVVSPSDGTLEAIHF
AEGDTVTPGAVLGAVTEGAATAKPAEAAPAPAAAAAPAPAPAAAPGGSANSGSAAFKAAD
ASQADKPLSPSVQRVVTENNLDASAIAPTGPKGNITKGDALAAIGAAPAKAGAPAPAPVA
AAAPRADQPREERVKMTRLRQTIARRLKESQNTAAQLTTFNEVDMTTVMALRTQYKDAFE
KAHGVKLGFMSFFTRAVVAALKEIPAVNAEIDGTDIIYKNHYDIGVAVGTEKGLVVPVLR
DADTLSLAGIEKGIAALGKAARDGDLTLDQLQGGTFTITNGGTYGSLMSTPILNAPQSGI
LGMHNIVQRPMAVNGQVEIRPMMYLALSYDHRIVDGKEAVTFLVRIKQLLEDPARALLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcctgacccccaccctcggtgaatccgtctccgaggcgaccatcgccaaa
tggtccaagaaggtcggcgacgccgtcaagaaggacgagatgctggtcgagctggagacc
gacaaggtctcgctggaggtcgtctcgccgtccgacggcacgctggaggccatccacttc
gccgagggtgacacggtgaccccgggcgcggtcctgggggccgtgaccgaaggcgccgcc
accgccaagcccgccgaggccgccccggccccggccgccgccgctgcgcccgcaccggcc
cccgccgctgccccgggtggttcggccaacagcggatcggccgccttcaaggccgccgat
gcgtcgcaagccgacaagccgctgtcgccgtcggtgcagcgcgtcgtgaccgagaacaat
ctggacgcctcggcgatcgcgccgacgggtccgaagggcaacatcaccaagggcgacgcc
ctggccgccatcggggccgcgccggccaaggccggtgcgccggcgccggcgccggtcgcg
gccgccgccccgcgcgccgaccagccgcgcgaggagcgggtcaagatgacccggctgcgc
cagaccatcgcgcgccgcctgaaggaatcgcagaacacggccgcccagctgaccaccttc
aacgaggtggacatgaccacggtcatggccctgcggacccagtacaaggacgctttcgag
aaggcccacggcgtcaagctgggcttcatgagcttcttcacccgcgcggtcgtcgcggcg
ctgaaggagatcccggccgtcaacgccgagatcgacggcaccgacatcatctacaagaac
cactatgacatcggcgtcgccgtcggcaccgagaagggtctggtcgtgccggtgctgcgc
gacgccgacaccctgtcgctggcgggcatcgaaaagggcatcgcagccctgggcaaggcc
gcccgcgacggcgacctgacgctggaccagctgcagggcggcaccttcaccatcaccaac
ggcggcacctacggctcgctgatgtcgaccccgatcctgaacgcgccccagtcgggcatc
ctgggcatgcacaacatcgtccagcgcccgatggccgtgaacggccaggtcgagatccgc
ccgatgatgtatctggcgctcagctacgaccaccggatcgtcgacggcaaggaggccgtg
accttcctggtgcggatcaagcagctgctggaagacccggcccgggccctgctggacctg
tag

DBGET integrated database retrieval system