KEGG   Brevundimonas subvibrioides: Bresu_0609Help
Entry
Bresu_0609        CDS       T01291                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00071  Fatty acid degradation
bsb00072  Synthesis and degradation of ketone bodies
bsb00280  Valine, leucine and isoleucine degradation
bsb00310  Lysine degradation
bsb00362  Benzoate degradation
bsb00380  Tryptophan metabolism
bsb00620  Pyruvate metabolism
bsb00630  Glyoxylate and dicarboxylate metabolism
bsb00640  Propanoate metabolism
bsb00650  Butanoate metabolism
bsb00900  Terpenoid backbone biosynthesis
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
bsb01212  Fatty acid metabolism
bsb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bresu_0609
   00630 Glyoxylate and dicarboxylate metabolism
    Bresu_0609
   00640 Propanoate metabolism
    Bresu_0609
   00650 Butanoate metabolism
    Bresu_0609
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bresu_0609
   00072 Synthesis and degradation of ketone bodies
    Bresu_0609
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bresu_0609
   00310 Lysine degradation
    Bresu_0609
   00380 Tryptophan metabolism
    Bresu_0609
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bresu_0609
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bresu_0609
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bresu_0609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsb04147]
    Bresu_0609
Enzymes [BR:bsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bresu_0609
Exosome [BR:bsb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bresu_0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADK99923
UniProt: D9QL68
Position
613293..614498
Genome map
AA seq 401 aa AA seqDB search
MTEAYIYDAVRTPRGKGKKDGSLHEITGLSLATQVLEALRDRNGLDTSKVDDVILGCVTP
IGELGADIARTAVLAAGWDQSVAGVQINRFCASGLEAVNMAAAKVKSGEADFAVGGGVEA
MSRVPMGSDGGAWPVDPSSAFPTYFVPQGVSADMIASKYGFSRDDVDAYSMESHKRAAAA
WADGRFGKSVVPVKNQLGLVHLDRDETIRPNTDMQSLGGLNPSFAMMGEMAFDAVINQRY
PEVERVNHVHTPGNSSGIVDGSAGVLIGTLEAGKALGLTPRARIKGAASIGSEPSIMLTG
PEFVTKKLLGKLGMTVADIDVWELNEAFAAVVLRYMQALDIPHDKMNVNGGGISMGHPLG
ATGAMITGIALDELERSGKETALITLCIGGGMGTATVIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctacgacgccgtgcggacgccgcgcggcaagggcaagaaggac
ggatcgctgcacgagatcaccgggctgagcctggcgacccaggtgctggaggccctgcgc
gaccgcaacggcctggatacctcgaaggtcgacgacgtcatcctgggctgcgtgaccccg
atcggcgaactgggcgcggacatcgcccgcaccgccgtcctcgcggccggctgggaccag
agcgtcgccggcgtccagatcaaccgcttctgcgcctcgggcctggaagccgtgaacatg
gcggccgccaaggtgaagtccggcgaggccgacttcgccgtcggcggtggcgtcgaggcc
atgagccgcgtgcccatgggctcggacggcggggcctggccggtcgatccgtccagcgcc
ttcccgacctatttcgtgccccagggcgtgtcggccgacatgatcgcgtccaagtacggc
ttcagccgggacgacgtcgacgcctactcgatggagtcgcacaagcgcgccgccgccgcc
tgggccgacgggcgcttcggcaagtcggtcgtgccggtcaagaaccagctgggcctggtc
catctggaccgcgacgagacgatccgtccgaacaccgacatgcagtcgctgggcggcctg
aacccgtccttcgccatgatgggcgagatggcgttcgacgccgtgatcaaccagcgctac
cccgaggtcgagcgcgtcaaccacgtccacacgcccggcaactcgtcgggcatcgtcgat
ggctcggccggggtgctgatcggcacgctggaggccggcaaggcgctgggcctgacgccg
cgcgcccgcatcaagggggccgcctcgatcgggtcggagccctcgatcatgctgacgggt
ccggagttcgtgaccaagaagctgctcggcaagctgggcatgaccgtcgccgacatcgat
gtgtgggagctgaacgaggccttcgccgccgtcgtgctgcgctacatgcaggcgctggac
atcccgcacgacaagatgaacgtgaacggcggcggcatctccatgggccacccgctgggg
gccacgggtgccatgatcaccggcatcgcgctcgacgagctggagcgctccggcaaggag
accgccctgatcaccctgtgcatcggcggcggcatgggcaccgccaccgtcatcgaacgc
gtctga

DBGET integrated database retrieval system