KEGG   Brevundimonas subvibrioides: Bresu_0761Help
Entry
Bresu_0761        CDS       T01291                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00071  Fatty acid degradation
bsb00072  Synthesis and degradation of ketone bodies
bsb00280  Valine, leucine and isoleucine degradation
bsb00310  Lysine degradation
bsb00362  Benzoate degradation
bsb00380  Tryptophan metabolism
bsb00620  Pyruvate metabolism
bsb00630  Glyoxylate and dicarboxylate metabolism
bsb00640  Propanoate metabolism
bsb00650  Butanoate metabolism
bsb00900  Terpenoid backbone biosynthesis
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
bsb01212  Fatty acid metabolism
bsb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bresu_0761
   00630 Glyoxylate and dicarboxylate metabolism
    Bresu_0761
   00640 Propanoate metabolism
    Bresu_0761
   00650 Butanoate metabolism
    Bresu_0761
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bresu_0761
   00072 Synthesis and degradation of ketone bodies
    Bresu_0761
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bresu_0761
   00310 Lysine degradation
    Bresu_0761
   00380 Tryptophan metabolism
    Bresu_0761
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bresu_0761
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bresu_0761
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bresu_0761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsb04147]
    Bresu_0761
Enzymes [BR:bsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bresu_0761
Exosome [BR:bsb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bresu_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADL00075
UniProt: D9QLZ1
Position
complement(758020..759222)
Genome map
AA seq 400 aa AA seqDB search
MREAVIVSTARTPIGRAYRGAFNDTAPQQLGAHAVKHAVARAGVDPAEIEDVIMGAALQQ
GGTGTNVARQIALAAGLPSSVPGMTLDRQCASGLMGIATAAKQVVFDQQKMAVGGGLESI
SLVQNQHMNLFRMKDEALLKLSPHIYMSMLETAEVVSRRYGISRDRQDEYALQSQQRTAA
AQAAGHLDAEIVPMTTTMQVMDKATGQASAKEITLSKDEGNRADTTLEGLKALKPVFGGG
EEIQQGEFITAGNASQLSDGASASVIMEAGEAVRHNLVPLGAYRGMAVAGCEPDEMGIGP
VYAVPKLLKRHGLTMDDIGIWELNEAFASQVLYCADTLGIPMDRLNLSGGAISIGHPYGM
SGARMTGHVLIEGKRRGARYGVVTMCIGGGMGAAGLFEIY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagcggtgatcgtctcgacagcccggaccccgatcgggcgcgcctatcgcggg
gcgttcaacgacaccgcgccccagcagctgggggcgcacgcggtcaagcacgccgtcgcc
cgcgccggcgtcgatccggccgagatcgaggacgtgatcatgggtgcggccctgcagcag
ggcggaaccggcaccaatgtcgcgcgccagatcgccctggcggcaggcctgccgtcgtcg
gtgcccggcatgaccctggatcggcaatgcgcgtccggcctgatgggcatcgccacggcc
gccaagcaggtggtgttcgaccagcagaagatggcggtcggcggcgggctggagtccatc
tcgctggtccagaaccagcacatgaacctgttccggatgaaggacgaggcgctgctcaag
ctgtcgccccacatctatatgtcgatgctggagacggccgaggtcgtgtcgcgccgctat
ggcatctcgcgcgaccgccaggacgagtacgccctgcagtcgcagcagcggacggcggcg
gcccaggcggccggacatctggacgccgagatcgtgccgatgaccacgaccatgcaggtg
atggacaaggccaccggtcaggcgtcggcgaaggaaatcacgctgtcgaaggacgagggc
aaccgcgccgacaccacgctggaagggctgaaggcgctcaagccggtgttcgggggcggc
gaggagatccagcagggcgagttcatcaccgccggaaacgcctcgcagctttcggacggc
gcgtccgcctcggtcatcatggaggcgggcgaggcggtccggcacaatctcgtgccgctg
ggtgcctatcggggcatggccgtggcgggctgcgagcccgacgagatgggcatcggcccc
gtctatgccgtgccgaaactgctgaagcgccacgggctgacgatggacgacatcggcatc
tgggagctgaacgaggccttcgcctcgcaggtgctctactgcgccgataccctgggcatc
ccgatggaccggctgaacctgtcgggcggggccatctcgatcggccatccctacggcatg
tcgggcgcgcggatgaccggacacgtcctgatcgagggcaagcggcgcggggccagatat
ggcgtcgtcaccatgtgcatcggcggcggcatgggcgcggcaggcctgttcgaaatctac
tga

DBGET integrated database retrieval system