KEGG   Brevundimonas subvibrioides: Bresu_2253Help
Entry
Bresu_2253        CDS       T01291                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00260  Glycine, serine and threonine metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bresu_2253
Enzymes [BR:bsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Bresu_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADL01563
UniProt: D9QJK2
Position
complement(2256547..2257563)
Genome map
AA seq 338 aa AA seqDB search
MRYDFGSDNTAGMAPAALRGLIEANADYARAYGADDITTRAADQIRRRLDADAEIRFVFS
GTAANAIALSMLAYPHEAVLAHHAAHVCTDETGAPGFFGQGVGLIGLPGLSGKIDSRALE
AALDEPEVGHRQPPAALSLTQSTEYGTVYTEEELRHLIEPVKERGYGVHLDGARLANAAA
AGFDLTQIARLGVDVLVFGGAKAGGLCTEAIVMFDRSLARRVDNRLKQAGQTASKGRFLA
APFLGMLESNAWEDGAAHANLMAQRLAAGIATRSPFILAHPVEANAVFVRMPPEAHAAIN
AAGWACYRFDDGSVRFVCSWATTEAAVDEVLETIAGLG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgattttggttccgacaacaccgccgggatggccccggccgccctgcgtggc
ctgatcgaggccaacgccgactatgcgcgcgcctatggggccgacgacatcaccacgcgg
gccgccgaccagatccggcgtcggctggatgcggatgcggaaatccggttcgtgttctca
ggcacggccgccaacgccatcgccctgtcgatgctggcctatccgcacgaggcggtgctg
gcccatcacgccgcccacgtctgcaccgacgagacgggggctccgggctttttcggacag
ggtgtcggcctgatcggccttccgggcctgtcgggcaagatcgacagtcgcgcgctggaa
gcggccctggacgagcccgaggtcgggcatcgccagccgcccgccgcgctcagcctgacc
cagtccaccgaatacggcaccgtctatacagaagaagagctgcggcatctgatcgagccg
gtgaaggagcgcggttacggcgtgcatctggacggggcgcggctggcgaacgcggcggcg
gccggtttcgatctgacccagatcgcgcgtctgggcgtcgatgtgctggtattcggcggg
gccaaggccggtggcctgtgcaccgaggcgatcgtcatgttcgacagatccctggcgcgc
cgggtcgacaaccggctgaagcaggccgggcagaccgcttccaagggccgtttcctggcg
gcacccttcctcgggatgctggagtccaacgcctgggaggacggggccgcccatgccaat
ctgatggcgcagcggctggcggccgggatcgccacgcggtccccgttcatcctcgcccat
cctgtcgaggccaatgcggtcttcgtgcgcatgccgcccgaggctcacgccgctatcaat
gcagcaggctgggcctgctaccggttcgatgacggctcggtgcggttcgtctgttcctgg
gccacgaccgaagcggccgtggacgaggtgctcgagacgatcgccggcctcggctag

DBGET integrated database retrieval system