KEGG   Brevundimonas subvibrioides: Bresu_3047Help
Entry
Bresu_3047        CDS       T01291                                 

Definition
(GenBank) O-methyltransferase family 2
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00906  Carotenoid biosynthesis
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Bresu_3047
Enzymes [BR:bsb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     Bresu_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_12 Methyltransf_25 MTS HTH_23
Motif
Other DBs
NCBI-ProteinID: ADL02353
UniProt: D9QP90
Position
complement(3121788..3122888)
Genome map
AA seq 366 aa AA seqDB search
MTETFSDRWRAWRNGLIGDPGFQRWASRFPLTRPVARRRAQALFDLSAGFIYSQIAQACV
RSGLLTRLAKGPATVAELSTVVDLDTDATLRLARAAVALKLAEPAGPDRYGLGVEGAALL
GAPGVAAMIEHHALLYADLADPLALLRRGGGGGALAGYWPYAEGETPDPDAAAAYSGLMS
ASQAMVSAQVLDAYDVSRHRRLMDVGGGQGTFLRAVAARAPALSLSLFDLPPVAARARAA
FAADGIRLEATGGSFFDDPLPRGADVISLIRILHDHDDGPALDILRAVRAALEPGAILLI
GEPFAAEPGAERVGDAYFGMYLLAMGSGRPRPTREVIGMCQTAGFSVARRVSTAMPMIAG
LVVARA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagactttttctgaccgttggcgtgcctggcgaaacggcctgatcggcgatccc
ggattccagcgctgggcttcgcgatttccgctgacgcggccggtggcgcggcggcgagcc
caggcgctgttcgacctgtcggccggcttcatctattcgcagatcgcccaggcctgcgtc
cgatccggcctgttgacgcggctggcgaagggacccgccacggtcgccgaactgtccacc
gtcgtcgatcttgacaccgacgcaaccctccgcctcgcccgcgctgccgtcgccctgaag
ctggccgagccggccggtcccgaccgctatggtctgggcgtcgagggggcggccctgctg
ggggcacccggcgtcgcggccatgatcgagcaccacgccctgctctacgccgatctcgcc
gatccgctggccctgctgcgccgcggcggcggcggcggggccctcgcgggctactggccc
tatgcggagggcgagacgccggatccggacgccgccgccgcctattccggcctgatgtcg
gcgtcccaggccatggtgtcggcccaggtgctggatgcgtacgacgtctcgcgccaccgc
cgcctgatggacgtcgggggcgggcaggggaccttcctgcgcgccgtcgccgcccgcgcg
cctgctctgtcgctgtccctgttcgacctgccgcccgtcgccgcccgcgcccgtgcggcc
ttcgccgccgacggcatacggctggaggccaccgggggaagcttcttcgacgatcccctg
ccgcgcggggccgatgtgatcagcctgatccgcatcctgcacgaccacgacgacgggcca
gcgctcgacatcctgcgcgccgtcagggccgccctggagcccggcgcgatcctgctgatc
ggggagcctttcgcggccgaacccggggccgaacgggtcggcgacgcctatttcggcatg
tacctgctggccatgggatcggggcggccccgcccgacacgcgaagtgatcggcatgtgc
cagacggcagggttctcggtcgcccgtcgggtttcgaccgccatgcccatgatcgccgga
ctggttgtcgcccgcgcctga

DBGET integrated database retrieval system