KEGG   Brevundimonas subvibrioides: Bresu_3221Help
Entry
Bresu_3221        CDS       T01291                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00260  Glycine, serine and threonine metabolism
bsb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01130  Biosynthesis of antibiotics
bsb01230  Biosynthesis of amino acids
Module
bsb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bresu_3221
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bresu_3221
Enzymes [BR:bsb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bresu_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADL02527
UniProt: D9QFL2
Position
complement(3313353..3314183)
Genome map
AA seq 276 aa AA seqDB search
MTTSRIDARFAALKAEGRAGFVAYVMAGDPSRDEALAILRGLPAAGADIIELGFPFSDPM
AEGPPIQRAALRGLKAGLTLKGTLDLARAFREGDADTPLILMGYLNPIESYGYDAFARDA
AAAGVDGCIVVDCPPEEADPLTDALDAAQVSLIRLATPTSDDARLEVIARRTSGFVYYVS
VAGVTGVKEAQSASVAPAVERVRRASGLPVAVGFGVKTPERAAEIARVADAVVAGSVLVD
EVAAALDANEPVATRVLSKVKALADAVRGARVGETV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccgcatcgacgcccgcttcgccgcgctgaaggccgagggccgggccggc
ttcgtcgcctatgtgatggccggcgacccctcgcgtgacgaggccctggcgatcctgcgc
ggcctgcccgccgccggggccgacattatcgaactgggctttccgttcagcgacccgatg
gccgagggtccgccgatccagcgcgcggcgctgcgcggcctcaaggccggcctgacgctg
aagggcacgctcgacctcgcccgggccttccgtgagggcgacgccgacacgcccctgatc
ctgatgggctatctgaacccgatcgagagctacggctacgacgccttcgcccgcgacgcg
gcggcggccggcgtcgacggctgtatcgtcgtcgactgtccgccggaagaggccgatccg
ctgacggacgccctggacgcggcgcaggtctccctgatccgcctggccacgccgacgtcc
gacgacgcccggctggaggtcatcgcgcggcggacctcgggcttcgtctattacgtctcc
gtcgccggcgtcacgggcgtaaaggaggcccagtcggcctccgtcgcgcccgccgtcgaa
cgcgtgcgccgcgcttcgggcctgcctgtcgccgtcggcttcggggtcaagacgccggaa
cgcgccgcagagatcgcccgtgtcgccgatgcggtcgtcgccggttcggtgctggtggat
gaggtcgccgccgccctcgacgcgaacgaaccggtcgcaacccgcgttctgtcgaaggtg
aaggccttggccgacgccgtgcgcggtgcacgcgtgggcgaaaccgtctaa

DBGET integrated database retrieval system