KEGG   Bipolaris sorokiniana: COCSADRAFT_109913Help
Entry
COCSADRAFT_109913 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    COCSADRAFT_109913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsc04131]
    COCSADRAFT_109913
Membrane trafficking [BR:bsc04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    COCSADRAFT_109913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin zf-RING_UBOX zf-RING_5 zf-RING_11 zf-rbx1 zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 19130107
NCBI-ProteinID: XP_007696370
JGI: Cocsa1_109913
UniProt: M2RQM4
Position
Unknown
AA seq 1334 aa AA seqDB search
MAAENIDDAPLPKARDDSHLQKPQQTIEPDSDDEEDDDDTADDDVDEEPKLKYSRLTRDL
GPIYRNGDATATFMVAGDKMIIGTHNGNIHALNLPAFNILRTYNAHPAASVTALSVSPLL
ASQPFVPSASDLRSADQASASSRRTDSPAGNTSSPRAPRQAQVPPTPSNQIYIASSSIDG
HVCVSSLVDPKDVTLRNFGRPVQAVALSPDYKNDRSYLSGGLAGELIHTVGGPIGVRSNA
NTSAASQAAHGWLGAIGLGGHGGRDTILHSGEGTITAIKWSLSGKFVAWANEHGVRLMRT
DLHLDSADSDDAWKRIGIIEKPNRRVWQDMASVWKPRIEWIDDQSLESDDDAIMSMNGHH
LVDKADATLPHNRSSQPAKEGNKKNIEKLIIGWGDTAWIVHVRPGGAGVGRNVGERSVGT
ADVIRCIHFDDCIVSGISLYTPSLLLVLAYRTRDDDDNPVSGPDTTPRGGRQRRTNGLSP
ELKLIDAATSDEVEVDSLTVSRYESLSAADYHLGTLYVPHPKTMTPAQRSALEAIGGGIW
DVGASAARIFSSGASVMNLQIGSDKPPSRAPSMSSASAGNISGSTPTKRQQPVHPNAASA
GLKVFIQSPYDCVLAIKRELSDHFQWELEHENYKDAWELLEDHPEIISSVVQIPSDASDT
GTPVNKQGSLHEFFADDNSQTTLSATRANQNSAVEKEKRRIGDLWVQQLVSAGDWKQAGK
VAGRVLGTSARWEHWVWKFAQTNHFNEISPYVPKKPIQPPLPSMVYEVILGHYIIHDRIR
FKHLLEDWDPDLFDINSVIEAIKSKLSAGDVTEESIEGDVQGRDWRILQDGLAKLFLASG
RQREALRCYIRLQNSEAAMTLIRDFHLVEAVRDDIPGFIMMGVSKELMKSASTKLEELEE
ASAEAINVLVEEGCRGTIPASDVESQLQAKGPSFRPFLHFYLRKLWKPEMHERTAKTAKE
RVAEDRLVADGKLVAEEFADLMVELFAEYDRPLLMEYLRKSQSYDLSKATAECERREYIP
ELVHILSKTGQTKRALYLIIEKLSDVSFAISFAKEQDDPDLWNDLLEYSMDKPHFIRGLL
EEVGTAIDPIKLVRRIPEGLEIEGLRDGIGRMVREYEIQYSISEGVARVLRGEVAAGMDT
LRSGQKRGVKFEVVPCNGGLSGKQAKHHHAKGQIDIETKGMDPATAAKLTAKAEKSTKAV
NTANTPTIDPTPPGPTEGDAPPGHCVGCHRPFTLPTAEEESAITDGTTPLPPSRDTLVGF
ACGHVFHLACLLPRTNASASVAAGLQQQLANDAQESGGRWTRSVGAKVAHAHVIKKAVGR
GCVVCREREVVGTE
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaaacatcgacgacgctccgctgcccaaggcgcgcgacgactctcacctg
caaaagccccagcagaccatcgagccggactcggacgacgaagaagacgacgatgacacg
gccgacgacgatgtcgacgaggaacccaagctcaagtacagtcgcctcactagagacttg
ggccccatataccgcaatggtgacgcgacggccaccttcatggtcgctggagacaagatg
attataggcacacacaatggaaacatccacgcgttgaacttacctgccttcaacatcctg
cgcacctataatgcccaccctgccgcctcggtcaccgctctctctgtatcgccgctgctt
gcctcccagccctttgtgccctccgcctcggacctgaggtctgccgaccaggcaagtgct
tcctctcggcgaaccgactcgccagccggcaatacttcttctcctcgcgcaccgcgccaa
gcccaagtcccacccacgccctcgaaccagatatacattgcttcctcgtccatagatgga
catgtctgtgtgtcttcgctcgttgacccaaaagatgtcacgctgcgcaatttcggtcgt
ccagtgcaagccgtagccctctcgcccgactacaaaaatgatcgctcgtacttgtctggt
ggactggctggcgagttgatccataccgttggtggacccataggcgtgcgatccaacgcc
aacaccagcgcggcatcgcaggctgcacatgggtggctcggcgcaataggcctcggcggg
catggaggcagggacaccattttgcattcaggcgaaggcaccatcactgccattaagtgg
tctctgtctggcaagttcgtggcctgggcgaacgaacatggcgtgcgcctcatgcggacg
gacctgcacctggacagcgcagattcagacgatgcctggaagagaatcggcatcatcgaa
aaaccaaaccgccgcgtatggcaagatatggccagcgtatggaaaccgcgaatagaatgg
attgacgaccagtcgcttgagtctgacgacgatgctatcatgagtatgaatggacaccac
cttgtggataaggccgatgctacactaccgcacaaccgatcttcccaacctgccaaggaa
gggaacaagaagaacattgagaagctcatcataggatggggagataccgcttggatcgtt
cacgtgcgccctggaggagctggtgttggccgcaatgtgggtgagagatcggttggaaca
gccgatgtcatccgctgcattcatttcgacgactgtattgtttctggcatttcgctttat
accccttctttacttcttgttcttgcataccggacacgcgacgacgacgacaacccggtt
tctgggccggatactactccccgtggaggaagacagcgtcgcacaaatggtctctctcca
gaactcaaactcatagatgctgcgacctcggatgaggttgaagtcgattctttaactgtc
agtagatatgagagcctttcagctgctgattaccacttgggtactctatatgtcccacat
ccgaagacgatgactcctgcgcaaagaagtgcattggaagccatcggcggagggatatgg
gatgttggtgcgagcgcagcacgtatatttagttctggagccagtgtcatgaaccttcaa
atcggctccgacaagccaccatcaagagcgccatccatgtcttcggccagtgctggaaac
atttctggttcaacacctaccaagcgccaacaaccggtacatccaaatgctgccagcgca
ggtctaaaggttttcatacaaagtccatatgactgtgtattggctatcaagcgagagctt
tcggatcatttccaatgggagttggaacatgaaaactacaaagatgcatgggaactgtta
gaggatcatcctgagattatctcatcagtcgtacagataccatcagacgcctctgatact
ggtacgccagtaaacaaacaaggaagcttacacgagttcttcgccgatgacaattctcaa
acaacattgtctgctaccagggctaatcaaaactcggcagtagagaaagagaagcgtaga
atcggagatttatgggtacagcagctcgtcagtgctggcgattggaaacaagcaggcaag
gtggcgggacgggtactggggacttccgcgcggtgggaacactgggtgtggaaatttgcc
cagacgaaccatttcaacgagatttcgccgtacgtccctaagaaaccgatacagccgcca
ctaccttccatggtatacgaagtaattcttgggcactacatcattcacgaccgcatacgc
ttcaagcatctacttgaggattgggatcctgatctttttgacattaatagtgttattgag
gctatcaagagcaaactctctgctggcgatgttactgaggagtctatcgaaggagatgtg
caaggaagagattggcgaatattgcaagatggtttggcgaagttgtttttggcaagtggt
cggcaaagagaggcactgcgctgctatatccgcctgcagaattcagaagcagccatgact
ctgattcgcgacttccatcttgtggaagccgttcgtgatgatatccctggattcatcatg
atgggtgtctccaaagagctgatgaagtcagcgtcaacaaagctggaggagttggaagag
gcatcggcggaagctatcaatgtccttgtcgaggagggttgccgaggcaccatcccagca
agtgatgttgagagtcaactgcaagccaaaggaccatcattcaggccctttttgcatttc
tatctacggaagctttggaagccggagatgcatgagcgcactgctaagacagccaaagaa
cgagtagctgaagatcgtttggtggccgatggcaagcttgttgctgaggagtttgcagac
cttatggtggagctatttgcagagtatgaccgaccgctgctgatggagtacctgcgcaaa
tcccagagctacgatctgagcaaggctacggcggaatgcgagagaagagagtatattcca
gaacttgtacatatcctctccaagacgggtcagacgaagcgtgctctgtacctcatcatt
gagaagctctccgatgtcagcttcgccatctctttcgccaaggaacaggacgaccctgac
ctctggaacgatctactagaatactctatggacaagccgcattttatccgcggtcttctc
gaagaagtcggcacggcaattgacccaatcaaactcgtacgccgcatccctgaaggtctt
gagatcgaaggactgcgagatggtattggccgtatggtccgcgagtacgaaattcaatat
tccatctccgaaggcgttgcaagagtgctacgtggtgaagtagcagccggtatggataca
ctacgctctggccagaaacgcggtgtcaaattcgaagttgtaccctgtaacggtgggctc
tccggaaaacaggcaaagcaccaccacgccaaggggcaaatcgatatcgagaccaaaggc
atggaccccgcgactgccgcaaaactcacggccaaagcagaaaaatcaacgaaagccgta
aacacagctaatacaccaaccattgatcctactccacctggcccaacagaaggcgacgct
ccgcctggccactgcgtcggctgccaccgtccttttaccctccccacagccgaagaagaa
tccgccatcactgacggaaccactccattgcctccctcccgcgacacactagtcggcttt
gcatgcggccacgtcttccacctcgcgtgtctcctaccaaggacaaacgcaagcgcaagc
gtcgcagcgggactacagcagcagcttgcaaacgacgcccaagagagcggcggcagatgg
acacgcagtgtgggtgcgaaggtggcgcatgcgcatgttatcaagaaggcggtgggtagg
gggtgtgttgtttgcagggaaagggaagttgtgggtacggagtaa

DBGET integrated database retrieval system