KEGG   Bipolaris sorokiniana: COCSADRAFT_151944Help
Entry
COCSADRAFT_151944 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    COCSADRAFT_151944
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     COCSADRAFT_151944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 19131574
NCBI-ProteinID: XP_007704621
JGI: Cocsa1_151944
UniProt: M2RX25
Position
Unknown
AA seq 341 aa AA seqDB search
MFARQVFRPARTLHQQVRRYASEAPKSGGNNGVLYTGIGAAGLAGAYLFLRGGDSPSGQK
GNAPPSEEANKIPSSTGGPAKKAFTGGDQGFLSLVLDKSEIVNHNTKKLTFKLPEEDMES
GLPVASAVITKYKGPEMQKPVIRPYTPISDVDQKGTVDFIIKAYPNGPMSEHMHSMEPGQ
RLDIKGPIPKFQWTPNKFEHIALIAGGTGITPMWQTARAIFRNPEDKTKVTLVYGNVTEE
DILLKREFEELENTYPQRFRAFYVLDNPPESWQGGKGYITKELLKTVLPEPKEGEKIKLF
VCGPPGMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccagacaggtattccgcccggccaggacgctgcaccagcaagtccgccgatat
gcatccgaagcgcctaagagcggcggcaacaatggtgttctctacacaggaattggtgct
gctggtcttgcaggtgcctacctgttcttgaggggtggtgattcaccatcagggcagaag
ggcaacgcaccaccgtcagaggaggccaacaagatcccttcctcaaccggtggccctgct
aagaaggccttcaccggaggcgaccaaggcttcctgtcgcttgtgttggacaagtctgag
attgtcaaccacaacaccaagaagcttaccttcaagttgcctgaagaggacatggagagc
ggtctgcctgtagcttctgccgtcatcaccaagtacaagggtcccgaaatgcagaagccc
gttattcgaccgtacactcccatcagcgacgtagaccagaagggcacagtggatttcatc
atcaaggcttacccgaacggacccatgtcggagcacatgcacagcatggagcctggccag
cgactagatatcaagggacccattccaaaattccaatggacacccaacaagtttgagcac
attgcgctgattgctggtggaactggtatcactcccatgtggcaaacagcacgcgccatt
ttccgcaaccccgaggacaagaccaaggtgacgctcgtatatggcaacgtgactgaagag
gacattctgctcaagcgcgagtttgaagagctggagaacacttacccccaacgattccgg
gcattttacgtcttggacaacccaccagagtcgtggcaaggcggcaagggatacatcacc
aaggagcttctgaagactgtgcttccagaacccaaggagggggagaagattaagctgttt
gtttgcggaccccccggcatgtacaaggccattagcggtggcaagaagagcccgtctgac
caaggcgagcttgacggctacctgaaggagcttggctatagcaaggaccaggtgtacaag
ttttag

DBGET integrated database retrieval system