KEGG   Bipolaris sorokiniana: COCSADRAFT_157010Help
Entry
COCSADRAFT_157010 CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00052  Galactose metabolism
bsc00500  Starch and sucrose metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCSADRAFT_157010
   00500 Starch and sucrose metabolism
    COCSADRAFT_157010
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     COCSADRAFT_157010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 BNR
Motif
Other DBs
NCBI-GeneID: 19131797
NCBI-ProteinID: XP_007696158
JGI: Cocsa1_157010
UniProt: M2T2A5
Position
Unknown
AA seq 638 aa AA seqDB search
MFRSSPLLSLALGTLSAVGAQELPAVLTADIIQGLGNNTLFTRWRPTYHFSGPAGWLNDP
SGMLYDPTTKMYHLHYQWHPNHVNWGNISWGHATSKDMITWTDVGGWENDQAQSLGTGPR
ADSRNSSYYGLGIFSGSGQPYNLQGEQDGTLINFYTSVQHLPTNWALPYIPGTETQSIAI
SNDGGETWEQYAGNPILSHPPEGWNITGWRDPFVEPWPEMDALLGHEEPHWYMAMGSGIK
GEGGGGRIPFYSAPATNLTDWTFLGALWEPKRNETLGSLLETGTYGFNFEVSNFFSLKDE
DDDVHYYALMGTEGGNLTWHPRAQWGLWNEGQVNKRENGSVEFTPLAGGAIDSGLLYAVT
SFVDSKNDRRIQWGWANEENNNFAITQTGYQGAMAIPREMYVIKTSHLVNNDSQLTTKGN
TRVVEHGNGTFTGYTLGARPLPEIVEALHNGSEPQVIDTGKDGCANGDVSGNGTSHMHLQ
VTLSDFTGPAGVVIAQSPNHEEQTVVWYSPENYTINVDRSHSSTIVEFANYTMIGYFYPY
TFANGTTESLHMDIFVDGSLVEIHVNDRFWLTTRIYPARTDSTGFGIWAEEGSTVKAKDL
KVWDIDFNVFPERPENSSSKLIYDTPEETNNYVWWTGN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgctcttcccctcttctgagccttgcactcggcacactgtctgctgtcggtgca
caggaattgcccgctgtgctaactgcagacattatccagggtttgggtaacaacaccctc
ttcacaagatggcgcccgacctaccatttcagtgggcccgctggatggctaaatgaccca
agcggtatgctgtacgatcctacgacaaaaatgtaccatttgcattaccaatggcacccc
aaccacgtgaactggggcaacatctcttggggccatgccacctccaaggatatgatcaca
tggactgatgttggaggctgggaaaatgaccaagctcagtctctcggcactggacccagg
gctgattcccgaaactcgagctactacggtttgggcatcttttccggcagcggccagccg
tacaacctccagggtgagcaggacggtacgcttatcaatttctacacttcggtacagcat
ttgcctaccaactgggctctaccttatatccccggaactgagacgcagagcattgccatt
tccaatgatggtggtgagacttgggagcagtatgctggaaaccccatcttgtcccacccg
ccagagggctggaacattaccggatggcgtgatcccttcgttgagccttggccggaaatg
gatgctctccttggacatgaggagccacactggtacatggccatgggctctggcatcaag
ggagagggtggcggtggtcgcattcccttctacagcgcccctgcaaccaacttgactgac
tggactttcttgggtgctctctgggagccaaagaggaacgagactcttggttctctgctt
gagactggaacatacggtttcaacttcgaggtatcaaactttttctctctgaaggacgag
gatgacgatgttcactactacgcactcatgggtaccgagggtggaaaccttacctggcac
ccccgtgcacaatggggtctctggaacgagggacaagtcaacaagcgtgaaaatggctcg
gtcgaattcactccgcttgccggtggtgcgatcgactccggactgctttacgctgtaacc
agctttgtggactcgaagaacgaccgacgcattcaatggggctgggctaatgaggagaac
aacaactttgccattactcagacagggtaccaaggcgctatggccattcctcgggaaatg
tacgtcatcaagaccagccacctggtcaacaacgactcgcagttgactaccaaaggcaac
actcgtgttgttgagcacggcaacggtacttttacaggatacactcttggtgcccgccct
ctgcccgagattgtcgaagctctccacaatggctcggagcctcaagtcattgacactggt
aaggatggttgcgctaacggagacgtctccggcaacggcaccagccatatgcatcttcag
gttaccctttccgacttcactggccctgctggtgtcgttattgcgcagtcgcccaaccac
gaggagcagaccgttgtgtggtacagcccggagaactacaccatcaatgtcgaccgttcg
cactcgtctacgattgtcgagtttgccaactacaccatgattggctacttttacccatac
acttttgccaacggcaccactgagtctctgcacatggacatctttgttgatggctccctg
gtcgagatccacgtgaacgaccgcttctggctcacaacccgtatctaccctgcccgcact
gacagcactggattcggcatctgggccgaggagggctccaccgtcaaggccaaggacctc
aaggtctgggatatcgacttcaacgtcttccccgagaggccagagaactcgagtagcaag
ctcatctatgatactccagaggaaaccaacaactatgtttggtggactggaaactaa

DBGET integrated database retrieval system