KEGG   Bipolaris sorokiniana: COCSADRAFT_162163
Entry
COCSADRAFT_162163 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00910  Nitrogen metabolism
bsc01100  Metabolic pathways
Module
bsc_M00531  Assimilatory nitrate reduction, nitrate => ammonia
bsc_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    COCSADRAFT_162163
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     COCSADRAFT_162163
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske Pyr_redox Fer2_BFD Rieske_2 NIR_SIR_ferr Rubredoxin_C Amino_oxidase GIDA K_oxygenase
Other DBs
NCBI-GeneID: 19132161
NCBI-ProteinID: XP_007701924
JGI: Cocsa1_162163
UniProt: M2SJW4
Position
Unknown
AA seq 1157 aa
MAETEPIVTQGIEPSSGESHSPPGDRHITATWGSKDGNISNRQWNDAEANKLPEKVADLE
KKGEINNDRPRKRIVVVGLGMVGIAFIEKLMKYDVKRREYDVVVIGEEPHLAYNRVGLTS
FFQHRQVENLYLNPQEWYSSMPEGALSYHLNTLVTEINSEKNTVKTSSGESVPYDILVLA
TGSDALLPRHTPGHDAQGVFVYRTIEDLQRLIQFSSSRKGTTGAVVGGGLLGLEAAHAMM
DLEDFAKVKLIERNRWVLSRQLDGDAGGMVVEQVRALGLDVMLSKRVGKILTTEDNFVKG
VVFEDGEEMECSCICFAIGIKARDELARRAGIKCADRGGGIVVGPDLATSQRDIYAIGEC
ASWENQTFGLIAPGVEMADVLAFNLTQAKAHAPRKFKAPDLSTKLKLLGVEVASFGDFFA
DRDGPKNLPGRQRADSKEPNAKTTRDKVKNLTDGPAPPPVKALTYKDPFQQVYKKYLFTM
DGKYLLGGMMIGDTKDYIKLVPMVKNQKPLEIPPSELIVGAQKGDDDGSDLSDDTQICSC
HNVTKGDVVNATKDGTCKSIGDVKSCTKAGTGCGGCMPLVQTIFNKTMASMGNEIKNHLC
PHFEYSRADLFNIIYVKGLKDFAAVMKEAGKDANSLGCEACKPTIGSIISSLYNKHLLEV
NNRGLQDTNDRFLANIQRNGTFSVVPRVSGGEITPEKLIIIGTVAKKYNLYTKITGGQRI
DMFGARKQDLPDIWQELVDGGMESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEE
RYKSIRGPHKFKGGVSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSELLAKD
VPPDDVVPILDRYLAFYIRTADKLQRTARWMENLPGGIKYLQEVILQDKLGICADLEKQM
EDLVGTFFCEWTEVLKDPKKRAWFSQFANTSETIIDTIEPTQERGQERPSYWPKDSVTED
FRGTKWTELSWQPLVKASEFQDADTGDSKAIKRGDTQLAVFKVRGKYYCTQQMCPHKRAF
VLSDGLIGDDLANNKLWVSCPYHKRNYELSGENAGKCANDESVNIAVFPIEEREDGWLYV
KLPSVEELDSVLGTSKFKIKKSESEDPFVALDKKLQRLQLKGRKGVPVSHLEGGLGEKGK
TAQILAGGERGAGGLDW
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcggaaacggaaccgattgtcacacaaggcatcgagccttcatcgggtgaatcacac
tcgccgccgggtgaccgtcacatcacagcgacctggggatcaaaagatgggaatatatca
aatcggcaatggaacgatgcggaagcaaacaaactacctgaaaaggtagcggatctggag
aagaagggtgaaatcaacaatgatcgcccacggaaaagaatcgtggttgtaggtttgggc
atggtcggcattgcttttatcgaaaaactcatgaagtacgacgtcaagcggagagaatac
gacgtcgttgtcattggcgaagagccgcacctcgcatacaaccgagttggtctaactagc
ttcttccaacatcgccaagtagaaaacttgtatctcaatccgcaagaatggtattcttcc
atgccagaaggcgcattgagttaccacctcaacactcttgtcaccgagattaattccgag
aagaatactgttaagacatcatctggagagtcagttccatacgacatcctagttctagca
acgggttccgatgctcttcttccccgacacacgcccggccacgatgcacaaggcgtattc
gtataccgcaccatcgaggatttgcaaagattgattcaattttcttcatcacggaaagga
accaccggcgcagtcgtgggcggcggtctgctcggccttgaagccgcacatgcgatgatg
gatctagaagactttgccaaagtcaagctgatcgaaagaaaccgctgggtcctgtcgagg
caattagatggcgatgccggtggtatggttgtggagcaagtaagagcactgggcctggat
gtaatgctaagcaagagggtgggcaagattctgactactgaggacaactttgtcaagggt
gtggtatttgaggatggcgaagagatggagtgctcttgtatttgcttcgcgattggcatc
aaagcccgagatgaactagccaggagggcgggcatcaaatgtgctgacagaggaggcggc
atagtcgtcggacccgatctagcaacatcccaacgcgatatctatgccattggcgagtgt
gcaagctgggaaaatcagacctttggcctcatcgcccctggcgtcgagatggccgacgta
ctagctttcaacttgactcaagcgaaagcacacgcaccgcgaaagttcaaagctccagat
ctcagcacaaaactcaaattgctaggggtcgaagttgcaagtttcggggatttcttcgcc
gatcgcgatggacccaaaaacttgcctggacgccagcgcgccgatagcaaggaaccgaat
gcgaagacgacacgagataaggtcaagaatctgacagatggaccagcaccaccaccagtt
aaggcgctcacatacaaagatccatttcagcaggtatacaaaaagtacttgtttaccatg
gacggaaagtatctgctaggcggcatgatgattggcgatacaaaagactacatcaagctt
gtgcccatggtgaaaaaccagaaaccgctcgagataccccccagcgagctcattgtcggc
gcacaaaagggcgacgacgatggttctgatctatccgatgacactcagatctgctcatgc
cacaacgtcaccaaaggcgatgtagtcaatgctaccaaagacggaacatgcaagagcatc
ggcgatgtcaagtcttgcaccaaagccggcactggctgtggtggctgtatgccgctcgtc
caaaccattttcaacaagaccatggcgtccatgggcaacgagatcaagaaccatctctgc
ccacactttgagtactctcgtgccgacctcttcaacatcatctatgtcaagggtctcaag
gatttcgccgctgtgatgaaggaggcaggaaaggacgccaactccctgggatgcgaagcc
tgtaaaccgactattggaagcatcatctcttcgctgtataataaacatctccttgaggtg
aacaaccgcggtctccaagatacaaacgatcgatttttggcaaacattcagcgcaatggc
acattttccgtcgttccccgagtttctggcggcgagatcacaccggagaagcttatcatc
attggaacagtggcgaagaaatacaacctctacaccaagattacgggaggccagcgcatc
gacatgtttggtgcgcgcaagcaagacctcccagatatctggcaagagctcgttgacggc
ggcatggagtctggtcatgcgtatgcaaaatcgctccgaaccgtcaaatcatgtgttgga
accacatggtgccgcttcggcattggtgatagtgtaggcatggctgtgcgtctagaagag
cgctacaagtctattcgtggtccacacaagttcaagggcggagtttcaggctgtgtccgc
gaatgcgcagaggcccaaaacaaggactttggcctcattgctaccgaaaagggattcaat
atctttgtcggtggcaacggtggtgcaaagcccagacattccgagctattggccaaggat
gtgccaccagacgacgtggtccctattctcgatcgctatctcgcattctacatccggacg
gccgacaaactgcaaagaacagcccgatggatggaaaaccttccaggcggtatcaagtac
ctccaagaagtcatcctgcaagacaaactcggcatctgcgccgatctagagaagcaaatg
gaagatctcgtgggcactttcttctgcgaatggaccgaagttctcaaagaccccaagaaa
cgcgcctggttctcgcaattcgcaaacacctcggaaaccatcatcgacaccatcgagcct
acgcaagaacgtggccaggaacgcccttcctactggcccaaagactccgtcaccgaagac
ttccgcggcacaaaatggacagagctctcctggcaacccttggtcaaagcctcagagttc
caagatgcagatacgggtgatagtaaagcgatcaagcgcggcgacacacaactcgcggtg
ttcaaagtccgcggcaaatactattgcacgcagcaaatgtgcccgcataagcgcgccttc
gtgctctccgacggcctcatcggcgacgacctcgcaaacaacaaactctgggtctcgtgc
ccttaccacaaacgcaactacgagctctctggcgaaaatgcgggtaaatgtgcaaatgat
gagtccgtcaacattgctgtgttcccgattgaagagagggaggatgggtggttgtatgtc
aagctaccgagtgtggaggagctggatagcgttctagggacgagcaagttcaaaattaag
aagagtgaaagcgaggatccgtttgtggcgctggataagaagttgcagcggttgcagctt
aaggggaggaagggcgtgccagtttcgcaccttgaagggggactgggagagaaggggaag
acagcacaaatactggctggcggcgagaggggtgctgggggcttggattggtaa

DBGET integrated database retrieval system