KEGG   Bipolaris sorokiniana: COCSADRAFT_165047Help
Entry
COCSADRAFT_165047 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00010  Glycolysis / Gluconeogenesis
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCSADRAFT_165047
Enzymes [BR:bsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     COCSADRAFT_165047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 19132354
NCBI-ProteinID: XP_007705293
JGI: Cocsa1_165047
UniProt: M2SPV2
Position
Unknown
AA seq 598 aa AA seqDB search
MAENKIPLGRYMWERIHQIGVDTIFGVPGDFNLQFLDQIFHVDGLKWTGNQNELNASYAA
DGYARIKNVPGCFVTTHGVGELSALNGIAGSMSENVKVIHVVGQTTRAMQKNHMMIHHSI
GSKPNHQVYNKASEGLRFAAAELWDIENAPSEIDRVLRECVIKSGPVYIFLPLDLSAELV
DKSLLDKKIDLAPQVDEKAQEKAINAITSAIAEAKQPTVVVDALVHRFGAIKEAQQVVKK
LNVPFFSTNMGKGIVDETEETFVGVWNGEVSTPGVKEVAKAADLVITLGYVPCDTNTAGF
SRQLDEKKVIHINPFDVVVKGTSYPSTSIQPLLAALSASLPSPAQHSIAKPQLPPPRTPL
DADAKNLTQSWLWPTMEAFIKSGDVVVSETGTSNPGIGDITFPKDITLITQIYYGSIGFA
TAATLGADLARRELEAANKRNKGRTILVTGDGSMALTIQEVGTMIKAKCKAVIFVINNEG
YTIERLIWGARQSYNDIVPHNYSHLLPLYHHPDSASSFHRAATKEELTAILAKPQVQQPE
NVQLVELVLDKLDTSWKLGTVLAWRSEEHKEYLTREGFVDTYGGWSLEEKAGGNIKWS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaacaaaatccccctcgggcgttacatgtgggaacgtatccatcaaatcggt
gttgacacgatcttcggtgtaccaggcgacttcaacctccaatttctcgaccaaattttc
cacgtcgatggcctgaagtggactggcaaccaaaatgagctgaatgcatcttatgctgca
gacggctatgcccgcataaagaatgtccccggatgttttgtcaccactcatggtgtcggt
gaattaagcgcactgaatggtattgcgggcagcatgtctgagaacgtaaaggtcatacat
gtcgttgggcaaactacgcgcgcaatgcagaagaatcatatgatgattcatcatagcatt
ggctcgaagccaaatcaccaagtatacaacaaggccagtgaggggttacgatttgccgct
gcagagctctgggacattgaaaatgcaccaagcgagattgaccgcgtactccgagagtgt
gtgatcaagagcgggccagtatacattttcttgccgttggatctaagtgccgagttggtg
gacaagagtttactggacaagaagatcgatctggccccacaagtcgatgagaaggcacag
gagaaggcaatcaatgccattaccagtgcgattgccgaggccaaacaaccaacagtcgta
gtagatgcgcttgtgcaccggttcggtgccattaaagaagcccaacaggtagtcaagaag
cttaatgttccgttcttctcaacaaacatgggcaaaggcattgttgacgagaccgaagag
acatttgttggcgtatggaatggcgaggtcagtactccaggtgtcaaggaagttgcaaaa
gcagctgatctcgtcataacgctgggatatgtcccatgtgataccaacacggctggtttc
tcgagacagttggacgaaaagaaagtgatccacattaacccattcgatgttgttgtcaag
ggcacatcttatccgtccacctccatacaaccgctcctcgccgctctatccgcttctctc
ccctcaccagcccaacactcaatagccaagccacagctccctcctccacgcacccctctg
gacgcagacgccaagaacctaacgcaatcctggctctggcccacgatggaggccttcatc
aagtccggcgacgtcgtcgtcagcgaaacaggtacctcgaaccccggaatcggcgacatc
accttccccaaagacattactctcataacgcaaatatactacggcagcatcggttttgcg
actgcagccacgcttggtgccgatctggcaaggcgggagctagaggcggcgaacaagcgt
aacaagggaaggacgatactggttactggcgacggatccatggcattgacaattcaggag
gttggcaccatgatcaaggcaaagtgcaaggctgtgatatttgtcatcaacaacgaggga
tataccattgagcggttgatctggggtgctcgacagtcatacaacgacattgtacctcac
aactactctcacctcctccccttatatcaccatccagattcggcctcgtcgttccaccgc
gcggcaacaaaggaagaacttaccgctatcctagcgaaacctcaggtgcagcagcccgag
aacgtgcagcttgtagagctagtactggacaagctggacacgagctggaagctcggcacg
gtactggcgtggaggagcgaggagcacaaggagtatctgacgcgagaaggattcgtagac
acatatggtggatggagtcttgaagaaaaagccggtgggaacataaagtggagctag

DBGET integrated database retrieval system