KEGG   Bipolaris sorokiniana: COCSADRAFT_165237Help
Entry
COCSADRAFT_165237 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00350  Tyrosine metabolism
bsc00360  Phenylalanine metabolism
bsc00380  Tryptophan metabolism
bsc00901  Indole alkaloid biosynthesis
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    COCSADRAFT_165237
   00360 Phenylalanine metabolism
    COCSADRAFT_165237
   00380 Tryptophan metabolism
    COCSADRAFT_165237
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    COCSADRAFT_165237
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsc04147]
    COCSADRAFT_165237
Enzymes [BR:bsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     COCSADRAFT_165237
    4.1.1.105  L-tryptophan decarboxylase
     COCSADRAFT_165237
Exosome [BR:bsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCSADRAFT_165237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 19132369
NCBI-ProteinID: XP_007705447
JGI: Cocsa1_165237
UniProt: M2SPD0
Position
Unknown
AA seq 522 aa AA seqDB search
MDSSQFRKAAKGAIDEIAQYYDTLEERPVLPAVKPGYLRPLIPSSTPEEGEPWEAIQADI
DRVIMPGLTHWQSPKFMAFFPCNSSFEGMLGEMYSGAFNAAAFNWVCSPAITELETVVMD
WVAKLIALPSDFLSDGEGGGIIQGTASEVILTALVAARERIIRRKLGDMPEGEERIDAAA
DIRSKLVALGSEHAHSSTQKAAVIAGTRFRTVPAPKESNYSVTAAALRSTIEACRAKGLE
PFYFTITLGSTGTCAIDDLAGVAQLAQEYPDLWIHVDAAYAGSALVCPEYQYLCPPIASF
DSFNFNLHKWLLVNFDCSAFFIKKRRDLMDTYSITPSYLRNPHSDQGLVTDYRDWQIPLG
RRFRSLKVWFVLRSYGVSGLRAFIRKHVELGVYFQNLLEQRKDLFRVETEAAFGLVTFQV
KPKAVAEQDGNAGVAANRPDPSHGTLQNGFQGDAEAQYAEMVNQRTKEVYESVNSKGDFF
LTSTVIGGRYVIRVVSATTKSEEKWMKMLFEELMEVAEGKTT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggattcttcacagttccgaaaggcggcaaaaggagccattgacgaaattgcacaatac
tatgacacactagaggaacgaccagtcctgcccgctgtcaaacccggctatctccgccct
ctcatcccatcctcaaccccagaagaaggcgagccatgggaagccattcaagcagacatc
gaccgcgtaatcatgccgggccttacgcactggcaatcccccaaatttatggccttcttc
ccctgcaactcatccttcgaaggcatgttgggtgaaatgtacagcggagccttcaatgct
gcggccttcaactgggtctgctcgcccgccatcactgaactcgaaaccgtcgttatggac
tgggtcgccaagctcatcgccctacccagtgacttccttagcgacggcgaaggtggaggc
atcatccaaggcaccgccagcgaagtcatcctcaccgcgctcgtcgccgcccgtgaacgc
atcatccgccgcaaactcggcgacatgcccgagggcgaagaaagaatcgacgccgcagca
gatattcgcagcaaactcgtagctctcggctctgaacacgcgcattcttcaacccagaaa
gcagcagtcatagcaggcacgcggttccgcactgttcccgcacctaaagaatcaaactac
agtgtcaccgccgccgccctccgcagcacaatcgaagcctgccgcgccaaaggcctcgag
ccgttctacttcaccatcaccctcggcagcacgggtacctgcgccatcgacgatctcgca
ggcgtcgcgcagctcgcacaggagtaccccgatctctggatccacgtcgacgctgcatac
gccggttcggcgctcgtctgccccgaataccagtatctgtgccccccaatcgcatcgttt
gactcgttcaatttcaatctgcacaagtggcttcttgtgaactttgactgctctgctttc
ttcattaagaagaggagggatctcatggatacgtattccatcaccccgagttacctgcgg
aatccgcactcggaccagggtcttgtgactgattatcgcgactggcagattccgcttggt
cgccggtttcgcagcttgaaggtgtggtttgtactccggagctacggagtatcgggtctg
agggcgttcatacgcaagcatgtcgagttgggtgtgtattttcagaacctgctcgagcaa
cggaaggatctttttagagtggagactgaggcggcgtttggactggtgacttttcaagtt
aagcccaaggccgtagctgagcaagacggcaatgcgggtgtggcggcgaatcgacctgac
cccagccatgggacgctgcagaatgggttccagggcgatgctgaggcgcagtatgctgag
atggtgaatcagcggacaaaggaggtgtatgagagcgttaatagtaagggggatttcttt
cttacgagtacggtgattggggggaggtatgtaattcgtgttgttagtgcaacgactaag
agtgaggagaagtggatgaagatgttatttgaggagttgatggaggttgctgaggggaag
acgacatga

DBGET integrated database retrieval system