KEGG   Bipolaris sorokiniana: COCSADRAFT_165303Help
Entry
COCSADRAFT_165303 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
bsc  Bipolaris sorokiniana
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsc01001]
    COCSADRAFT_165303
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsc03021]
    COCSADRAFT_165303
Enzymes [BR:bsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     COCSADRAFT_165303
    2.7.11.23  [RNA-polymerase]-subunit kinase
     COCSADRAFT_165303
Protein kinases [BR:bsc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   COCSADRAFT_165303
Transcription machinery [BR:bsc03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     COCSADRAFT_165303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH CBF
Motif
Other DBs
NCBI-GeneID: 19132374
NCBI-ProteinID: XP_007705499
JGI: Cocsa1_165303
UniProt: M2SQP6
Position
Unknown
AA seq 404 aa AA seqDB search
MFTGYNNKKRVTERYKIVGFISSGTYGRVYKAEGRNGRTGEFAIKKFKPDKEGELQYSGI
SQSAIREMALCTELAHPNVVHTAEIILEDKCIYIVFEYAEHDLLQIIHHHNQPQRQAIPA
RTIKSILYQLLQGLVYLHKNWVMHRDLKPANIMVTSAGKIKIGDLGLARLFYKPLQSLFS
GDKVVVTIWYRAPELLLGSRHYTPAVDLWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPF
QRNQMQKIVEIMGMPTKDRWPLLTAMPEHHQLSSLLSSNASRFPRSQSGDGLERWYHQTL
NNNQYPIGSGPDTPGPEGLSLLKQLLEYDPQKRLTAEKALLHPYFTMHGKPAESCFEDSK
VKYPVRRVSQEDNDMRTSSLPGTKRSGLPDDSIMGRPAKRLKEG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccggctacaacaacaagaagcgcgtgaccgagcgctataaaatcgtcggcttc
atcagcagtggtacctatggacgtgtctacaaggccgagggccgcaacggtcgcaccggc
gagttcgctatcaagaagttcaagccagacaaggaaggtgagctgcaatactctggcatc
tcgcaatcagccattcgcgaaatggccttgtgcactgagcttgcccatccaaacgtggtc
catactgcagagattatcctagaagacaagtgcatttatattgtcttcgagtatgccgag
catgatcttttgcaaattatccatcaccacaaccaacctcagcgccaggccatccctgct
cgcaccatcaaatccattctgtaccaactgctgcagggccttgtctacctgcacaagaac
tgggtcatgcaccgagatctcaagccagcaaacatcatggtcaccagtgctggcaagatc
aagattggtgatctgggtctcgcccgcttgttctacaaaccattgcagtcgttattctcc
ggcgataaggttgtcgtgactatatggtatcgcgcgcctgagctgctgcttggtagtcgc
cactacacacctgcagtcgatttatgggcgattgggtgcatctttgccgagttgctttcc
ctgcggcccatcttcaaaggagaggaggccaaaatggatagcaaaaaaaccgtcccattc
cagcgcaaccaaatgcaaaagattgtcgagatcatgggcatgccgactaaggaccgctgg
ccacttctaacagctatgcccgagcatcatcaactctcgtctctcctatcaagcaatgcc
tcacgctttccgcgctcccagagcggcgatggattggagcggtggtaccaccagacactc
aacaacaaccaatatccaatcggctctgggccggacacacctggaccagagggactctct
ctcctcaagcaacttctcgagtacgaccctcagaaacgactcacggcagaaaaggcgctg
ttacatccatacttcaccatgcacggcaagcccgcagaaagctgtttcgaagactccaag
gtcaagtatccggtcaggagggtcagccaagaagacaacgacatgcgtacgtctagtctg
ccaggcactaagagaagtgggctcccagatgactccatcatgggccgtccagcgaagcga
cttaaggagggctga

DBGET integrated database retrieval system