KEGG   Bipolaris sorokiniana: COCSADRAFT_203750
Entry
COCSADRAFT_203750 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00100  Steroid biosynthesis
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
Module
bsc_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    COCSADRAFT_203750
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     COCSADRAFT_203750
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 19134274
NCBI-ProteinID: XP_007705072
JGI: Cocsa1_203750
UniProt: M2S9X1
Position
Unknown
AA seq 495 aa
MAKATADKGIKKLVEEPHGYEFLGPPGAFLISFGLPVLVYVFTFLCNDISGCPAPVLLHP
ESFSLEQLKKEVGWTGFSGLLNTQALLGTLGYYFLSLVLYRFLPGEECEGTELRSGGRLK
YRFNAFYSALFIITVLGAGTISQGVDFPVWTFIHDNYIGIVTSNILISYLLAIYVYVASF
SVKHPKDPSMRELAAGGHTGNMLYDWFIGRELNPRINLPIFGEVDIKAWCELRPGMLGWV
IMDLAFIVQQYRNFGRVTDSIILVTVAQTVYTFDALYMEPAILTTIDLIADGFGMMLSFG
DLVWVPFTYSLQTRYLSVYPVELGLSGVAGVLAVQGIGYYIFRAVNNEKNRFRTNPEDPR
VKHLKYIETAAGSKLLVSGWWGMARHINYLGDWFMSWSYVLPTAVSGYVIKNAAQDPVTA
AQTDAYFFKNSYGKYVVPGEAKGWGMIFTYFFMVYFAILLIHRERRDEEKCKKKYGKDWD
RYVVLVPWRIIPGIY
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggcaaaagcaaccgccgacaagggcatcaagaagctcgtcgaggagccccatggctat
gagtttctcggacctcctggagccttcctcatctcctttggtcttcccgttctagtctac
gtcttcacatttttgtgcaatgatatttctggatgcccggcacctgtgctcctccaccct
gagagctttagccttgaacagctaaagaaggaggtcggatggaccggcttctcgggtctg
ctcaacacacaggctctccttggtacccttggatactacttcctgagcttggtcctgtat
cgtttcctcccaggtgaagagtgtgagggcacggagctcaggtccggtggtaggctcaag
tacaggttcaatgccttctactctgctctcttcatcattacggtcctcggcgctggaact
atctcccaaggtgtcgactttccggtctggacttttattcacgacaactacattggcatt
gtcaccagcaatatcctcatctcctacttgctggccatctacgtctatgttgcttctttc
agcgtcaagcaccctaaggatccctccatgcgggagcttgcagccggcggccacactggc
aacatgctgtacgactggttcatcggacgcgaactgaacccacgtatcaacctgcccatc
tttggcgaagttgacatcaaggcatggtgcgaactgcgccctggaatgctgggatgggtc
atcatggaccttgcctttatcgtgcaacaataccgcaactttggccgcgtcaccgactct
atcatcctagtcaccgttgcgcaaactgtctacacctttgatgccttatatatggagccc
gccattctcactaccattgacctcattgctgatggtttcggcatgatgctgtcatttggc
gaccttgtctgggttccctttacctattccctccagacccgctatctctccgtctacccc
gtcgaactcggcctgagcggtgtagccggtgtattggccgtacagggtattggttactac
attttccgcgccgtcaacaacgagaagaaccgcttcaggaccaaccccgaagacccccgc
gtcaagcacctcaagtacatcgagacagccgccggctccaagctcctcgtcagtggctgg
tggggcatggcccgccacattaactaccttggcgactggttcatgagttggtcctatgtc
ctacccactgccgtatccggatatgtcatcaagaatgcggctcaggaccccgtcaccgct
gcccagaccgacgcctactttttcaagaacagctacggaaagtacgttgtacctggcgag
gccaagggatggggcatgatcttcacctacttcttcatggtctactttgccatcctgctc
atccatcgcgaacgtcgtgatgaggaaaagtgcaagaagaagtacggaaaggattgggat
cgctatgtggtgcttgttccctggaggatcatccccggtatctactaa

DBGET integrated database retrieval system