KEGG   Bipolaris sorokiniana: COCSADRAFT_220298Help
Entry
COCSADRAFT_220298 CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00052  Galactose metabolism
bsc00500  Starch and sucrose metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCSADRAFT_220298
   00500 Starch and sucrose metabolism
    COCSADRAFT_220298
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     COCSADRAFT_220298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 19134569
NCBI-ProteinID: XP_007701777
JGI: Cocsa1_220298
UniProt: M2S5G1
Position
Unknown
AA seq 637 aa AA seqDB search
MKFSSSRDLVVVLSFAMEATSRILVRQPTTIDYNAAPPNLSTLANNSLFETWRPKAHVLP
AFGQIGDPCMHYTDPATGLFHVGYLHLGASGATTSDLVTYKDLNPNSAPFIRAGGINDPI
AVFDGSVIEKGVNGTPTLLYTSVSYLPIQWTIRYTKGSETQSLAYATDGGKNFTKAKFGP
VIPSPPFAVNVTGFRDPYVFQSPQFDSLLSKKKDTWYTLISGGVHGVGPSLFLYAQYDDS
DAASFQTWEYLGEYWHEAANTTWTESNWAGRWGFNFEVANIFSLDEHGANPSTGETFLTV
GAEWSYAPIVPQVSDERDMLWVAGTQSLIDGKLTFEPTMAGRLDAGRSAYAAAGKPLSAD
SQPSWASGAPDRAITYLWLTGDLYGTSAFPTAQQNWTGSLLLPRELSRCYIDVLDTPLAR
ETGAWRIERESGEGTVRLATLCQKIAREVTTAFKAKATNVITLPADELSPGEQCKLPQIP
KENHYMLTASLTFPARTPGLKAGLTILSGAHETTRVVYDIGSERLSVERGSSSAAANTTQ
GIPTYDEEGLFRLFDLPSHVNASRIETLNLTIVVDGGVVEVHANDRFALSTWVRPWYADS
KGVGVFVEGEGEEEVQVGEVKVYEGLVDAWPKRNKTI
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcgtcgtcacgcgatttggtggtagtgttgtcgtttgcgatggaagcaaca
agtcggattctggtccgtcaacctacgactattgactacaatgccgctccacccaatctc
tctaccctagcgaataactcgctcttcgaaacttggagacccaaagcacatgttctaccg
gcgtttggccagatcggagatccgtgtatgcattatacggatcctgccactgggcttttc
catgtcggatatctgcatctgggggcatcgggcgcgacgacgagcgatttggttacgtac
aaggacttgaatcccaattccgcgccgttcatccgtgcaggcgggataaacgaccccatt
gcagtcttcgacgggagtgtgattgaaaagggcgtaaacggcacgcctacgctcctctac
acaagcgtcagctacctccccatccaatggacaatccgctacacaaaggggagcgaaaca
caatcactagcctatgccacggacggcggcaaaaactttacaaaagccaagttcggccct
gttatccctagccctcccttcgccgtcaacgtaacgggattcagagacccatacgtattc
caaagcccacaatttgattctcttctcagcaagaaaaaagatacatggtacaccctcatc
tccggcggtgtccacggtgtaggccccagtctcttcctctacgcccaatacgacgactca
gacgccgcctcattccaaacctgggagtatctaggcgaatactggcacgaagccgccaac
accacctggaccgaatccaactgggccggtcgctggggcttcaacttcgaagtcgcaaac
atcttctccctcgacgagcacggcgcaaatccctccactggcgaaacctttttaaccgta
ggcgcagaatggagctacgcacccatcgtgccccaagtgtccgacgaaagagacatgctc
tgggtcgctggcacccagtccctcatcgacggcaaactaacttttgaaccgacaatggcg
gggagattagatgcaggccgctccgcctacgcggcagccggcaagcctctctccgcagac
tcgcagcctagctgggcgagcggcgcccccgatcgcgcaatcacgtatctctggctcacg
ggcgatctctacggcacatccgccttccccacagcccagcaaaattggacgggctccctg
cttctcccgcgtgagctatcgcgctgctacatcgacgtgctcgacacaccgctagcccgc
gaaaccggggcgtggaggatcgagcgagagagcggagagggcacagtacggcttgcgaca
ttgtgccagaagatcgcacgggaagttacgactgcgttcaaggcaaaggcaacaaacgta
atcacgttgcctgcagatgagctttctcctggcgagcaatgcaaactaccccagatcccc
aaggagaatcactacatgcttactgcctctctgacctttcccgcgcgcacaccgggtttg
aaggcgggacttacgatcctctcgggcgcgcatgagacgactcgtgttgtgtacgatatc
ggctccgagcggctcagtgtggaacgtgggagttcgtctgcggcggcgaatacgacgcag
ggtatacctacgtatgatgaggagggtttgttccggctgttcgatttaccaagtcacgtc
aatgcctcgcggattgagacactgaatctgacgattgtggtggatggtggtgtggtggag
gtgcatgcgaatgatcggtttgctctgagtacgtgggtgaggccgtggtatgcggatagt
aagggtgttggggttttcgtggagggagaaggagaggaggaggtacaggtgggcgaggtg
aaggtttacgaggggttggtggatgcgtggccgaagaggaataagacgatttag

DBGET integrated database retrieval system