KEGG   Bipolaris sorokiniana: COCSADRAFT_267274Help
Entry
COCSADRAFT_267274 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00480  Glutathione metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCSADRAFT_267274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsc02000]
    COCSADRAFT_267274
Enzymes [BR:bsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCSADRAFT_267274
Transporters [BR:bsc02000]
 Other transporters
  Pores ion channels [TC:1]
   COCSADRAFT_267274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19135551
NCBI-ProteinID: XP_007695713
JGI: Cocsa1_267274
UniProt: M2RMW7
Position
Unknown
AA seq 240 aa AA seqDB search
MAHVNGNAPKITLYTNYRCPYAHRAHIVLKELGLPYEEVTIDLDTPREPWYLKINPRGLV
PAIKFNGEIITESAVVSTFLADAYPSHLFPATGSPEAALARAKINFFVDTWSTKAGSFWY
KILMQDSEEEKAKLSQEFIETVSKELEPLLKDAKPFFGGSEKLTLAEALTAPFIIRIYAF
SRRGVLPKSITTDLDALPNFSKWVAAVMKQESVTYVFDEDSIISSTVKRLEKMKEKNKVA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgttaatggcaatgcgcccaaaatcacgctatacacaaactatcgctgccct
tatgctcaccgagctcacattgttttgaaagaactgggtttgccttatgaggaagttaca
atcgatttggatactccgagagagccctggtatctgaaaatcaaccctcgaggtcttgtt
cctgccatcaagttcaatggcgagatcatcaccgagtcagccgttgtctcaacattcctg
gctgacgcctatccctcgcatctcttccctgcaacaggatctccagaagctgccctggcc
cgtgctaaaatcaatttttttgtcgatacctggagtaccaaggctggtagcttttggtac
aagatcttgatgcaggattctgaagaggaaaaggcaaagttgagccaggaatttattgaa
accgtgagcaaagaattggagcctcttctgaaagatgcaaagccattcttcggcgggagt
gagaaactcacactggcagaggcactaaccgcgcctttcattatccggatatatgcgttc
tcaagacgcggtgtactccccaagtccattacaacagatttggatgcacttcccaacttt
tccaagtgggttgcagcagtaatgaaacaagagagcgtgacatatgtttttgatgaggac
tcaatcatctcgtccaccgtcaagagactggaaaagatgaaagagaagaacaaggtagca
tag

DBGET integrated database retrieval system