KEGG   Bipolaris sorokiniana: COCSADRAFT_294198Help
Entry
COCSADRAFT_294198 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00220  Arginine biosynthesis
bsc00330  Arginine and proline metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01230  Biosynthesis of amino acids
Module
bsc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    COCSADRAFT_294198
   00330 Arginine and proline metabolism
    COCSADRAFT_294198
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     COCSADRAFT_294198
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 19136046
NCBI-ProteinID: XP_007706102
JGI: Cocsa1_294198
UniProt: M2SM23
Position
Unknown
AA seq 108 aa AA seqDB search
MINANSITIIFSPYHVGLRDYRVGDGPNRIRALGVVKELEKLGVMVHILKLLLVKDFERE
IGRSFKLLRRTSKAVTDVYAKQSFPLVLLGNCIVSARVAYRLGLKDLS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgctaattctattactattatcttttccccctatcatgttggccttcgtgat
taccgtgttggtgacggtcctaaccgcattcgagctctaggggtcgttaaagagctggaa
aaactcggtgtgatggtacatatactcaagcttctattagttaaggattttgaacgggag
ataggccgtagctttaagctactccggcggacgtctaaggcagtaacagatgtgtatgct
aagcaatcctttcctcttgttctattaggaaattgtatagtaagcgctagagttgcttat
aggctaggcctcaaagatcttagctag

DBGET integrated database retrieval system