KEGG   Bipolaris sorokiniana: COCSADRAFT_32499Help
Entry
COCSADRAFT_32499  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    COCSADRAFT_32499
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bsc03041]
    COCSADRAFT_32499
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     COCSADRAFT_32499
Spliceosome [BR:bsc03041]
 Complex C
  Other components
   Step II factors
    COCSADRAFT_32499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD T2SSE AAA_30 AAA_14 AAA_19 RimM DUF2075 SRP54 AAA_16 AAA_7 Herpes_ori_bp
Motif
Other DBs
NCBI-GeneID: 19136799
NCBI-ProteinID: XP_007694309
JGI: Cocsa1_32499
UniProt: M2T5W0
Position
Unknown
AA seq 1216 aa AA seqDB search
MDDLENLEFLSLVSKVTSEIQNHVGVSDKTLAEFVIDQHADCKDVADFKKQLEDVGAEFP
QSLVESIDRLILTLHPKYKNKGAGGKQGGANAEDDGDATSRKTRVFKGLAIPDREVEYDA
ADEEPMNDASQADALDDTFAMLEGLAGKAPGKPKERSRKRSMSPYDSGDDTSKSKRHRRR
DTSHSRSPSRSPRRGRQREQNDELVFEDEFGRTRTVKPSNKQRSRKKYRDEDIEEFRRQP
TPELDDEPVLYKIYDGKVTGVKDFGCFVNLQGVKGKVDGLVHVTQMMEGRVNHPSDLVSR
WQEVKVKVIKMENGRISLSMKEVDQRTGRDLAPGKRIASFGTGANSQGLGGIPGVDSSVP
VVEDGYNSRRNGMRKRMTSPERWEIKQLIASGVIPKSDYPDIDEDFNAHINGEGGFEEEE
DVDIEVREEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRAAMAGDTLAKERRDLKQQEAQ
EKAAKEAANVDLSSQWNDPMAQQRQFASDLRNTRTNEPSQALPEWKKISTNSRETSFGKR
TNMSIKEQRESLPVFKFRKQLLEAVAAHQILIVVGDTGSGKTTQMTQYLAEAGYANELVI
GCTQPRRVAAMSVAKRVAEEVGCTLGNEVGYTIRFEDKTSPDTRIKYMTDGILQREILLD
PMLSKYSCIMLDEAHERTIATDVLFGLLKKTLKRRPDMKLIVTSATLDADKFSEYFYKCP
IFSIPGRTFPVEVMYSREPESDYLDAALVTVMQIHLTEPAGDILLFLTGKEEIDSSCEII
SERMKALGPNVPELMILPIYGALPSEVASRIFEPAPAGSRKCVIATNIAETSLTIDGIYY
VVDPGFVKQSSYDGKLGMDRLQITPISQAQARQRSGRAGRTGPGKCFRLYTEAAFQNEML
PTTIPEIQRQNLSNTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYQLGALDDEGLL
TRLGRQMADFPMDPSLSKSLIKSVELQCSDEILTIVAMISATQNVFHRPRDKQQQADQKK
QKFNDPSGDHITLLNVYNGWKQGGFSTPWCHENFVMPKNMQRVRDVRNQLLQIMARHKHQ
VVSCGRNTIKVRQALCSGFFRNSARKDPAEGYKTLVEGTPVYLHPSSSLFGKPAEHVIYH
SLVETTKEYMHFCSAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNKFAGEDDWR
LSAQRKAGRGGGGTWG
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccttgagaacctcgagtttctatcgcttgtttccaaggtcacatcggaaata
caaaaccacgttggtgtctccgataagacacttgccgagttcgtcatcgaccaacatgcc
gactgcaaggatgttgccgacttcaagaaacagctcgaggatgttggcgccgagtttcca
cagagcttggtcgagagcatcgatcgccttattctgactctgcatcccaaatataagaac
aaaggcgcaggtggaaagcagggaggcgcaaatgcagaagacgacggagatgcaacaagt
cgcaaaacgcgtgtcttcaaagggttggccattcccgacagggaagtggaatacgatgcg
gcagatgaggagccgatgaatgatgcgtcccaggccgatgcgctggacgacacctttgcc
atgctggaaggactggcagggaaggcaccaggcaagcccaaggagcggtcgcgcaagagg
agcatgagcccatacgacagcggcgacgataccagtaagagcaaacgacacaggcggagg
gacacatcgcactctcgctcgccatccaggagtccgcggcgggggcgacaacgggagcag
aatgacgagttggtttttgaagacgaatttggccgtacacgaaccgtcaagcccagtaat
aagcagcgaagccgcaaaaagtatcgcgacgaagatattgaagagttccgacggcagccc
actcccgagctcgacgacgagccagtgctgtacaagatttacgacggcaaggtcacgggt
gtcaaggattttggctgctttgttaatctacaaggtgtgaaaggcaaggtcgacggactt
gtccatgtcacccagatgatggaggggcgagtcaaccatccatcagatcttgtgtcgaga
tggcaggaggtcaaggttaaagttatcaagatggaaaacggcaggatatcgctctcgatg
aaagaggtggatcagcggacaggccgtgatcttgcaccaggaaagcgtatagcatcattt
ggaaccggcgcgaactcgcaaggtcttgggggcattccaggagttgatagctctgtgcct
gttgttgaggatggctacaacagccgtagaaatggcatgcggaaacgtatgacttcgcca
gagcgatgggagatcaaacaactcatcgcctctggtgtaatccccaaatccgactacccc
gatattgatgaggactttaacgctcatatcaacggcgagggcggtttcgaagaggaagag
gatgttgacattgaagtccgtgaagaggagccaccctttttggccggtcagaccaagcaa
tcactggagctttcgccaattcgtgttgtcaaagcacctgatggctcgctcaaccgtgcc
gcaatggccggagacacactggccaaggaacgccgtgatcttaaacaacaagaagcacag
gagaaggctgcaaaagaagcggcaaacgtggacttgagcagtcagtggaatgatcccatg
gcccagcaacggcagtttgcaagcgatctccgcaacactcgaacgaacgaacccagtcaa
gcactgccagaatggaaaaaaatctccacaaacagcagggagacctcttttggcaagcgt
accaacatgagcatcaaagaacagcgggagtcgctgcctgtattcaaattcaggaagcaa
cttctcgaggctgttgcagcccatcaaatcttgattgtagttggtgatactggatctgga
aaaacaacacagatgacgcagtatttggccgaagccggttatgctaacgagcttgttatt
ggttgcactcagcccaggcgtgtagcagctatgagcgtcgccaaacgtgttgctgaggaa
gttggctgcactctagggaacgaggttggttacacgattcgatttgaagacaagacttca
ccggatacgcgtatcaaatacatgacggacggtatcctgcagcgtgagattctcttggac
cccatgttgtccaagtatagctgtatcatgctcgatgaggcccacgaacgtacgattgcc
acggatgtactgtttggtttactgaaaaagacgctcaagcgacgacctgacatgaaactc
atcgttaccagtgctaccctagatgccgacaagttctcggagtacttttataagtgtccc
atcttttcaatcccaggccgcacgttccctgtcgaggtcatgtacagccgggagcctgag
tctgattaccttgacgcagcattggttacagtcatgcagatccatttgacagaaccagca
ggtgacatcttgctcttcttgacaggaaaagaagaaatcgactcttcttgcgagattata
tctgagcgcatgaaggccttgggaccgaacgtgccagagttgatgattctacccatctac
ggtgccctgccatctgaagtggcgtctcgcatctttgagcccgcgcccgcaggcagtcga
aaatgtgtcattgctaccaatattgctgaaaccagtttgactattgacggcatctactat
gttgtagacccgggtttcgtcaagcaaagttcttatgacggaaagctaggcatggaccgt
ttgcagattacgcctatttcccaggctcaggctcgccaaagaagtggcagagcaggaaga
acaggacctggaaaatgtttccgtctgtacaccgaagcagcattccagaacgagatgctg
ccgacaactatcccagagattcaacgtcagaacttgtcaaacacgattctcatgttgaag
gctatgggcattaatgatctgttgcattttgatttcatggatccaccaccgaccaacacc
atgttgacagctctggaagagctgtatcagctgggcgcattggacgacgaagggttgctc
acgcgtcttggtcggcaaatggcggatttccccatggacccttctctctccaagtcactg
atcaagtcagtcgagctccagtgctcagacgagattctcacaatcgtggctatgattagc
gccactcagaacgttttccatcgtcctcgagacaagcagcagcaagcagaccagaagaag
cagaagttcaacgatccatctggcgaccacattacccttctcaacgtctacaatggctgg
aaacagggcggcttcagtacaccatggtgccacgaaaactttgtcatgcccaagaatatg
caacgcgtacgcgacgtacgaaaccagttgctgcagatcatggcacgacacaagcatcag
gtcgtgtcttgtggtcggaataccatcaaagttcggcaggcactctgctcaggtttcttc
cgcaattcagcacgcaaggatcctgccgagggctacaagacgcttgtcgagggtacacct
gtgtacctgcacccttcttcgtcgctctttggtaagcctgcagagcatgtcatatatcat
tcgcttgtcgagactaccaaagagtacatgcacttttgcagtgccattgaaccgaagtgg
ctagtggaagctgcacctactttcttcaaggttgcgccgacggaccgcttgagcaagagg
aagaaggcggagaggatacagccgctacacaacaagtttgcaggcgaagacgattggaga
ctgagtgcccagcgaaaggcaggaagaggcggtggtggtacttggggctga

DBGET integrated database retrieval system