KEGG   Bipolaris sorokiniana: COCSADRAFT_343871Help
Entry
COCSADRAFT_343871 CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 7 protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00500  Starch and sucrose metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCSADRAFT_343871
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     COCSADRAFT_343871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7 Nairovirus_M
Motif
Other DBs
NCBI-GeneID: 19137628
NCBI-ProteinID: XP_007702495
JGI: Cocsa1_343871
UniProt: M2SZK0
Position
Unknown
AA seq 455 aa AA seqDB search
MYRTLVVTASFLHAARGQLVGTQKEEVHPKLSWQSCTAPGSCTTQNGEVVVDANWRWLHT
KEGYTNCYTGNTWDTKYCPDNKSCAANCAIDGADYSGTYGITTSGNALKLNFVTKGSYST
NIGSRNYLMKDEKTYQMFKFTGNQEFTFDVDVSKLPCGFNGALYFVSMDADGGLSKYPGN
KAGAKYGTGYCDAQAPRDLKFINGEANVEGWKPSSNDQNAGVGGHGSSCAEMDIWEANSV
STAVTPHSCSTIEQTRCDGDSCGGTYSATRYAGVCDADGCDFNSYRMGVKDFYGKGKTVD
TSQKFTVVTQFVGTGDNLEIRRFYVQGGKVIPQPSSKIPGIDGNAINSKFCDQQKSVFGD
PTDFQKKGGMGGMAKALANGMVLVMSVWDDHNSNMLWLDSTYPTDKDPEKDLGVARGECA
TTSGVPKDLEANNADATVTYSNIKFGPLNSTFSAQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggactctggtagttaccgcttcttttctccacgcagctcgcggtcagctggtg
ggaacgcagaaggaggaagtgcaccctaagttgtcatggcaatcttgcactgccccagga
agttgtaccacccaaaacggcgaagtagtcgttgatgccaactggcgttggcttcatacc
aaggagggttacacgaactgttatactggcaacacttgggacacgaaatattgccccgac
aacaagtcgtgcgcggccaactgcgccatcgatggtgcggattattcaggcacctacggt
attactaccagcggcaatgccttgaagcttaacttcgtcaccaagggctcgtattccaca
aacattgggtcacgtaactacctgatgaaggatgaaaaaacctaccagatgttcaaattc
acgggcaatcaagagttcacgttcgacgtagatgtctcgaagctaccttgcggtttcaat
ggcgcactgtactttgtctctatggatgcagacggtggtctcagcaagtatccaggtaac
aaagccggtgctaagtacggaactggttattgcgacgcccaggctccaagggatcttaag
ttcattaatggcgaggccaatgttgaaggctggaaaccgtcgtcgaatgaccagaatgcc
ggtgtcggcggtcatggttccagctgtgcagagatggacatttgggaggctaactcggtc
agcacagcagtcactccacactcttgcagcacaattgaacaaacccgctgcgacggcgat
tcatgtggaggtacgtactcagccacacgctatgctggagtgtgcgacgcggatggttgc
gactttaacagctaccgcatgggtgtcaaagacttttatggaaaaggcaagacagtggac
acatctcaaaagttcacagtcgtcacacaattcgttggaacaggtgacaacttggagatc
aggcgcttctacgtgcaaggcggcaaagttattcctcaaccctcatccaagattccagga
atcgacggcaacgccatcaactccaagttttgcgaccagcagaagtctgtcttcggcgac
ccaactgacttccagaagaagggcggcatgggaggcatggccaaggctcttgctaatggt
atggttcttgtcatgagcgtgtgggatgaccacaacagcaatatgctgtggctcgattct
acataccccaccgacaaggacccagaaaaggatcttggtgttgctcgaggagaatgtgcg
acgaccagcggtgtaccaaaggatcttgaggccaataacgcagatgctacagtcacttac
agtaacatcaagttcggtcctttgaactcgaccttcagtgcacaatag

DBGET integrated database retrieval system