KEGG   Bipolaris sorokiniana: COCSADRAFT_34503Help
Entry
COCSADRAFT_34503  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00030  Pentose phosphate pathway
bsc00480  Glutathione metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
Module
bsc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COCSADRAFT_34503
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCSADRAFT_34503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsc04147]
    COCSADRAFT_34503
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     COCSADRAFT_34503
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     COCSADRAFT_34503
Exosome [BR:bsc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   COCSADRAFT_34503
  Exosomal proteins of colorectal cancer cells
   COCSADRAFT_34503
  Exosomal proteins of bladder cancer cells
   COCSADRAFT_34503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 19137689
NCBI-ProteinID: XP_007696630
JGI: Cocsa1_34503
UniProt: M2SZH5
Position
Unknown
AA seq 509 aa AA seqDB search
MADTVIQPQHEEVNAGNMELKDNTIIVVLGASGDLAKKKTFPALFGLHRNNFLPKNISIV
GYARTKMDHEEYLKRVKSYIKTPTKDLEKQLDEFCNFCTYVSGQYDQDDSFIQLEKHMQE
IEKGRKETNRVFYMALPPSVFITVSQHLKRNCYPKSGIARVIVEKPFGKDLPSSRELQKA
LAPDWSEDELYRIDHYLGKEMVKNILILRFGNEFFGATWNRNHIDNVQITFKEPFGTEGR
GGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSAEDIRDEKVRVLRGMASIEPKNVIIG
QYGKSLDGTKPGYKEDDTVPKDSRCPTFASMVAYIKNERWDGVPFILKAGKALNEQKTEV
RIQFKDVTSGIFKDIPRNELVIRVQPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSD
LKIPEAYESLILDALKGDHSNFVRDDELDASWRIFTPLLHYLDDNKEIIPMEYPYGSRGP
AVLDDFTSSYGYKFSDAAGYQWPMNEQKL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacagttatccagcctcaacatgaggaggtcaatgccggaaacatggagctc
aaggacaacactatcattgttgttctcggcgcctctggtgatttagccaagaagaagact
ttcccagctctcttcggtcttcaccgaaacaacttcctccccaagaacatcagcatcgtc
ggatatgcgcgcaccaagatggaccacgaggaatacctcaagcgcgtcaagtcgtacatc
aagacccccacaaaggacttggagaagcagttggacgaattctgcaacttctgtacctat
gtctcgggtcaatacgaccaggacgactcattcatccagctcgagaagcatatgcaagag
attgaaaagggccgcaaggagaccaaccgcgtcttctacatggctcttcctcccagtgtc
ttcatcacagtttctcagcacttgaagcgaaattgctacccgaagagcggcattgcccgc
gtcattgtcgagaagccattcggcaaggatctcccaagttcaagagagttgcaaaaggca
ttggctccagactggtctgaagatgagctctaccgaattgaccactacctgggtaaggag
atggtcaagaacattctcattctccgattcggtaacgagttctttggcgcaacctggaac
aggaaccacatcgataacgttcagattacctttaaggagccttttggcaccgaaggacga
ggaggttactttgacgagtttggcatcatccgagatgtcatgcagaaccacttgctgcaa
gtactgacactccttgctatggagcgaccaatttccttctcagcagaagatattcgtgac
gaaaaggtgcgtgtcctccgtggcatggcctccatcgagcccaagaatgtcatcatcgga
caatacggaaagtcgctggatggtacgaagccgggctacaaggaggatgacaccgtgccc
aaggactcgcgatgccccaccttcgcctccatggtcgcttacatcaaaaacgagaggtgg
gacggcgtgcccttcatcctcaaggctggaaaggcgctcaacgagcaaaagaccgaggtc
cgcatccagttcaaagacgttacttcgggtattttcaaggacattccccgtaatgagctt
gtcatccgagtgcagcccaacgagagtgtctacattaagatgaactccaagctgcccggt
ctcagcatgcagaccgttgtcacagagcttgatcttacctacaggcggcgattttccgac
ctgaagatcccagaggcatacgaatcgcttattctcgacgcgctcaagggcgaccactcc
aactttgttcgtgacgatgagctcgatgccagctggaggatcttcactcctctgctgcac
tatctggatgacaacaaggagatcattcccatggagtacccatacggctctcgtggtcct
gccgtattggatgactttacttcttcttacggatacaagttcagcgacgcagcaggatac
caatggccaatgaatgagcagaagttgtag

DBGET integrated database retrieval system