KEGG   Bipolaris sorokiniana: COCSADRAFT_350817Help
Entry
COCSADRAFT_350817 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
bsc  Bipolaris sorokiniana
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    COCSADRAFT_350817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-GeneID: 19138050
NCBI-ProteinID: XP_007705873
JGI: Cocsa1_350817
UniProt: M2SNR8
Position
Unknown
AA seq 529 aa AA seqDB search
MRFQLSDKETSRWLNIDIRPLPPSRRQWTAWTYSAFWLAWHVSLTNFTMGSSLVALGLSV
WQVMLAIVIGRAIIAAIAVAVGTIGADWGIGFPVYSRALWGMRGSYVPMFQRIVCGIVGI
ALQSYLGGICITAMLSAMFPSFHRMRNTLPAGANVQTQQLIGWVLFNLITVPFLCGKLEK
KRIVRVFVALNAYSFCVLFGIMIWAVVRAKGAGQLLTEGSLPDSDIGWGICKAVTTVVGS
IAVGLMSQPDYTRFARTPGAQVTGQWTSIMVFGTLMPLFGCITASATQSIYGKAIWNPTE
IALLWLQRDYSAKTRAASFFVSLGLMLCQLVVNTFENGFSTGMDLAALAPKYINIRRGAL
LALTIACGTCPWQLLTNAAVFLNVVASYTIIIGPILGIQIIDYFVLRSRRIQLSALYEIN
PDSAYYYTYGFNPRTILAWIVAWIPQLPGFINAVNPNIHVPFGAAKLYDLSFLFGGTVGA
LIYLGINLVFPPSNLGHVDEADVFKVSSEEEAGQRSIKAIVKREVNEVA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccaactctcagacaaagagacctcccgatggctcaacatagacatccgtcca
ctgccccccagccgccgccaatggactgcatggacctatagtgccttctggctcgcttgg
catgtctctctcactaattttaccatgggctcctcgctagtagccctgggcctctccgtc
tggcaagtcatgctcgccatcgtcatcggtcgcgccataatcgctgccattgccgtcgcc
gtcggtaccatcggtgccgactggggaattggctttcctgtatactcgcgcgccctctgg
ggaatgcgcgggtcctacgtccccatgttccaacgcatcgtgtgcgggattgtaggaata
gcattgcaatcctatctcgggggcatttgtatcacggccatgctgagtgcgatgtttcct
tctttccaccggatgcggaatacgctgccggctggggctaatgttcagacgcagcagttg
attggctgggtgctgtttaatttgatcacggtgccttttttgtgtgggaagctggagaag
aaaaggattgttcgcgttttcgttgcgctgaatgcgtattcgttctgcgtgctttttggt
attatgatttgggcggtggtgcgagctaagggggcaggacaattgttgacagagggctcg
ctgccagatagtgatatcggatggggcatctgtaaggcggttacgacagtggttggctcc
attgcggtgggtttgatgagccagcctgattacacgcggtttgcacgtacgccgggcgcc
caggtgacgggccagtggacgtctatcatggtgtttggcacgctgatgccactctttggg
tgcatcactgcatcagcaacccagtccatctacggaaaagccatctggaatcctacagag
atagccctgctctggctgcagagagattactctgcaaaaacccgcgccgccagcttcttt
gtgtcattgggtctcatgctgtgccagctcgtcgtcaatacttttgagaacggattcagt
actggcatggatctcgctgctcttgcacccaagtatatcaacatccgacgcggagctctc
cttgcgctcacaatcgcctgtggtacttgtccgtggcagctcttgacgaatgcagccgtc
tttctcaacgtcgtcgcatcgtataccatcatcatcggtcccattcttggtattcagatc
atcgattacttcgtcttgaggagtcgccgcattcagctctctgctctttatgagattaat
cctgattcggcgtactattacacgtacggtttcaatccgcgcacgattctcgcatggata
gtggcttggataccacaattaccagggtttatcaacgcagtcaacccaaatatccacgtg
ccgtttggagctgcaaagctttatgatctctcctttcttttcggcggaacggtaggggct
ttgatatatcttggaatcaaccttgtgttccctccgtccaatctggggcatgtggatgag
gctgacgtattcaaagtgtcttctgaagaggaagctgggcagcgtagtatcaaagcgatc
gtcaagcgggaggtaaatgaggtagcctag

DBGET integrated database retrieval system