KEGG   Bipolaris sorokiniana: COCSADRAFT_36105Help
Entry
COCSADRAFT_36105  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00510  N-Glycan biosynthesis
bsc01100  Metabolic pathways
Module
bsc_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    COCSADRAFT_36105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsc01003]
    COCSADRAFT_36105
Enzymes [BR:bsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     COCSADRAFT_36105
Glycosyltransferases [BR:bsc01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   COCSADRAFT_36105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 19138660
NCBI-ProteinID: XP_007699097
JGI: Cocsa1_36105
UniProt: M2SBP8
Position
Unknown
AA seq 458 aa AA seqDB search
MTSVLSWAESLSLLSLSVACAGVLANTLHGDGEPLVASIAFSGLAFVSCYALIRWLGDAF
MKRGFKGKDLCKLKQTEIPEMMGAVCAMVYLFIIIFFIPWPFYKDIVVATSGGGNRDIIK
ELELIETGRLLHRFPHNKLASYLSAILSLQTIVLLGVGDDLFDIRWRHKVLIPAFAVIPM
LVVYFVDFGVTQMVVPVPLRPYLGELFDLGWLYYVYMALMSIFSSNSINILAGINGIEVA
QSVVIAVLIVINDMLYLSPFAPYPHPATDSHLFSLYLLLPFIGVSVALLMHNWYPAKVFV
GDTYCYFAGMVFAVVAILGHFSKTLILLLVPQAFNFVYSAPQIFHVIPCPRHRLPRFNAR
TGLLEPSRVEFTKPLRKPIAESLKVLHRLRMLDVEVNAEGQVVSSSNWTLINLWLVWFGP
MREDRLAMGLLVFQFAIGILGLFVRHRMALLIFTADNL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtgtattgtcatgggcagaatcactttcactgttgtctctgtcagtcgcatgc
gctggtgtgttggcaaacacacttcacggtgacggtgagccgcttgtagcgtcgatagca
ttcagcggattggcgttcgtatcctgctatgcattaatacgatggcttggggatgccttc
atgaagcgtggcttcaaaggaaaggatctctgtaagttgaagcagactgagataccggag
atgatgggagcagtatgcgcaatggtgtatctcttcattattatctttttcatcccatgg
ccattctacaaggacattgtggtcgcaacctcagggggcggcaacagagatatcatcaag
gaactggaattaatcgagacgggcagacttctgcacaggtttcctcacaacaagcttgca
tcgtatctatcagccattctctcacttcagactattgtgctgcttggtgttggcgatgac
ttgttcgacataagatggcgccacaaggtgctcatcccagcttttgcagtcattcccatg
cttgtggtgtactttgtcgattttggcgtcacgcaaatggttgtccctgttccgctcagg
ccttacctgggcgagttgttcgatctcggatggttgtactatgtctacatggcactcatg
tccatcttctcttccaacagcatcaacattttggcaggcatcaacggcatcgaagtggct
cagtcggtggtcattgcagttctgattgttatcaacgacatgctttatctttcgcccttt
gcgccctacccccacccggcaacagactcgcatcttttctccctgtacctactgcttccc
tttattggagtctctgttgcgctgttgatgcataactggtatccggcaaaagtgtttgtg
ggcgacacgtactgctactttgcaggcatggtgttcgccgttgttgcaattctcgggcac
ttcagcaagacgctgatattgctccttgtaccacaagcattcaactttgtctactcggca
cctcaaatcttccatgtcattccgtgcccccgacatcggcttccccgtttcaatgcacgg
actggactgctggagccctcgcgcgttgaattcaccaaaccgctgcgaaaaccgatagcg
gagagtctcaaggtgctacaccggcttcggatgttggatgttgaagtcaatgcagaaggg
caggtggtttcgtcaagtaactggacgctaatcaatttatggctggtgtggtttgggccg
atgcgggaggatcggctggccatgggtttgctggtattccagttcgccattggcatcttg
ggcctgtttgttcggcatcggatggcattgcttatcttcactgctgataacttgtag

DBGET integrated database retrieval system