KEGG   Bipolaris sorokiniana: COCSADRAFT_39837Help
Entry
COCSADRAFT_39837  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00010  Glycolysis / Gluconeogenesis
bsc00030  Pentose phosphate pathway
bsc00051  Fructose and mannose metabolism
bsc00680  Methane metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
bsc01230  Biosynthesis of amino acids
Module
bsc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bsc_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bsc_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCSADRAFT_39837
   00030 Pentose phosphate pathway
    COCSADRAFT_39837
   00051 Fructose and mannose metabolism
    COCSADRAFT_39837
  09102 Energy metabolism
   00680 Methane metabolism
    COCSADRAFT_39837
Enzymes [BR:bsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     COCSADRAFT_39837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 19139577
NCBI-ProteinID: XP_007703117
JGI: Cocsa1_39837
UniProt: M2S1N2
Position
Unknown
AA seq 361 aa AA seqDB search
MVQASEVLSRKTGVIVGDDILTLFKHAQSEGYAIPAINVTSSSTVVAALEAARDAKSPII
LQLSNGGAAYFAGKGVANGKQEASIAGSIAAAHYIRSIAPAYGIPVVLHTDHCAKKLLPW
LDGMMDADEAYFKAHGEALFSSHMIDLSEEPKEWNIATTKKYLERAAPMKQMIEMEIGIT
GGEEDGVNNEDVDNNSLYTQPEDIYDIYKELSAVSPLFSIAAGFGNVHGVYKPGNVKLRP
ELLQKHQAYVKEKTNSKDDKPVFLVFHGGSGSSVDDFRQAISYGVVKVNLDTDMQWAYLS
GIRDYIQSKSGYLQTQVGNPDGDDKPNKKYYDPRVWVREGEKSMSQRIKVALDDFYTAGK
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagccagtgaagtcctgtcccgcaagaccggtgtcatcgtcggcgacgacatc
ctcacgcttttcaagcacgctcagtcagagggttatgccatccccgccatcaacgtcact
tcctcttccacagttgtcgctgccctcgaggctgcccgcgacgcaaagtcccctatcatc
ctgcaactgagcaatggaggcgccgcatactttgcaggcaagggcgtagccaacggcaag
caggaggccagcattgctggtagcattgctgctgcccactacatcaggtccattgcccct
gcatacggcatccccgttgttctccacacagatcactgcgccaagaagctcctgccttgg
ttggatggtatgatggatgccgacgaggcttacttcaaggctcacggagaggctctgttc
agctcgcacatgattgatctttctgaggagcccaaggagtggaacattgccaccaccaag
aagtacctcgaacgcgctgcgccaatgaagcagatgattgagatggagatcggtatcacc
ggaggagaggaggatggtgtcaacaatgaggacgtcgacaacaactccctctacactcaa
cccgaggacatctacgacatctacaaggagctgtccgctgtctctcctctcttctccatc
gccgccggctttggcaacgtccacggtgtctacaagcccggaaacgtcaagctccgcccc
gagctcctgcaaaagcaccaggcttacgtcaaggagaagaccaactccaaggatgacaag
cccgttttcctcgtcttccacggcggtagcggtagctctgttgatgacttccgtcaagcc
atctcatatggtgtcgtcaaggtcaacctcgacactgacatgcaatgggcctacctctcc
ggtatccgggactacatccagtccaagagcggctacctccagacccaagtgggtaacccc
gacggtgatgacaagcccaacaagaagtactacgacccccgtgtctgggtccgtgagggt
gagaagagcatgtctcagcgcatcaaggtcgctcttgacgacttctacactgctggcaag
gcttaa

DBGET integrated database retrieval system