KEGG   Bipolaris sorokiniana: COCSADRAFT_41892Help
Entry
COCSADRAFT_41892  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bsc  Bipolaris sorokiniana
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    COCSADRAFT_41892
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     COCSADRAFT_41892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase DUF739
Motif
Other DBs
NCBI-GeneID: 19140108
NCBI-ProteinID: XP_007705803
JGI: Cocsa1_41892
UniProt: M2S7N7
Position
Unknown
AA seq 285 aa AA seqDB search
MTRAAVGQMRSTASMASNLTQAQSLCRKAHQAGAKALFLPEAADYITTSGGLQLCKPVTT
SEFVLGLQDCAKQYNLAISVGIHEPVSSDAQKVKNTLIWITPQGEIAHRYQKLHLFDMNV
KDGPQMKESDGVERGLELGHPFESPVGRIGMQICFDLRFPEPALALSRRGAQVLLYPAAF
TTPTGKAGHWEILLRARAIEMQSYVIAAAQVGVHDDQGKRRSYGHSMIVDPWGKIVAELG
GDEGEDGKWADEGEIAVAELDLDYVENLRKDVPMTRRTDVYADVS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgcagcagtcggccaaatgcgctccacggcttccatggcctccaatctcacc
caagcccaatccctctgccgcaaagcccaccaagccggtgcaaaagccctcttcctccca
gaagcagcagactacatcaccacttccggtggcctccaactatgcaagccagtcacaacc
tctgaattcgtcctcggtctgcaagattgcgcaaaacaatacaatctcgccatctccgtc
ggcatccacgaacccgtctcctctgacgctcaaaaagtgaaaaacacccttatctggatc
acgccccagggagaaatcgcccaccgctaccagaaactacacttgttcgacatgaacgtc
aaggatggtccccagatgaaggagtcggatggcgtcgaacgcggccttgagcttggccat
ccctttgaaagtcctgtgggcaggataggcatgcagatatgttttgacctgcgctttccc
gagcccgcgcttgccctcagcaggcgaggtgcccaagtgcttttgtaccctgccgctttt
actaccccaacgggtaaggctggtcattgggagatactgctgcgtgcccgtgccattgag
atgcagagctatgtcatcgctgctgcccaggttggagtgcacgatgaccagggcaagagg
cggagttatggacacagcatgattgtggatccttgggggaaaatcgttgctgaactcgga
ggcgatgagggtgaagatgggaaatgggccgatgaaggtgagattgccgttgccgagctg
gaccttgattacgttgagaatttgcgcaaagatgtgcccatgacacggagaacagatgtc
tatgcagatgtttcttag

DBGET integrated database retrieval system