KEGG   Bipolaris sorokiniana: COCSADRAFT_87799Help
Entry
COCSADRAFT_87799  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00061  Fatty acid biosynthesis
bsc00071  Fatty acid degradation
bsc01100  Metabolic pathways
bsc01212  Fatty acid metabolism
bsc04146  Peroxisome
Module
bsc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    COCSADRAFT_87799
   00071 Fatty acid degradation
    COCSADRAFT_87799
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    COCSADRAFT_87799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsc01004]
    COCSADRAFT_87799
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsc04147]
    COCSADRAFT_87799
Enzymes [BR:bsc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     COCSADRAFT_87799
Lipid biosynthesis proteins [BR:bsc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   COCSADRAFT_87799
Exosome [BR:bsc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   COCSADRAFT_87799
  Exosomal proteins of breast cancer cells
   COCSADRAFT_87799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 19141208
NCBI-ProteinID: XP_007699398
JGI: Cocsa1_87799
UniProt: M2T6H6
Position
Unknown
AA seq 696 aa AA seqDB search
MPQDLKKLMPQAKAYRTGPYTCEVPNAQKVDGETVPRRNNAAKDGLILKPHDEVSTLYDI
LRHSAAKFGNAKAVGARRIVNIHEETKKIKKMVDGKEQEVDKKWQYFELSPYKYKSFVEF
EQMALSIGSGLKSLGLEPQDRLHLFAATSMQWLASAHGALSQSMAIVTAYDTLGEEGLKH
SMLQTKAKVMFTDPELLPRLVKPMNEAKDVRVVVYCTKNDPKQKDIDTLTQAHPHLKVIS
FDDLIKLGEENPAEPIPPKADDLACIMYTSGSTGTPKGVMIKHRNVVAAVAGVDVIVGKY
LGPGDVLITYLPAAHILEFVFENAVLYWGGTMGYGTIRTLSDQSVRNCAGDIRELKPTVM
VGVPQVWETIKKGIINKVEAGGALKSNMFWGAFAAKGFLLGSGLPGSGLLDTIVFNKVKE
ATGGRLRICMNGGGPIAKETQRFISIAITPMISGYGLTETCAMGALMDPLAWNEKALGEM
PGSIEMKLVDFADAGYFSTNKPPQGEIWIRGGGVVDGYLNMPEETKEAFTEDGWFKTGDV
GEFNANGEIRIIDRKKNLVKTLAGEYIALEKLESVYRSAPIVANICVYAAEDRQKPIAII
VPTEPQLKKIAAQVGVTGDHLEELVHDKKINSAVLKQLQDAGQKGGLASFEMIEGVVLAD
EEWTPQNGLTTAAQKLNRKGILEHYKKEVDQAYGKS
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggacctcaagaagttgatgccccaggcaaaggcatacaggactggtccctac
acctgtgaagtccccaatgcccaaaaggtagatggcgagacggtaccgcgccgcaacaac
gcggccaaagatggtctcatcttgaagccccacgacgaggtctcgactctctacgacatc
ctgcgacactcggccgccaagtttggaaatgcaaaggccgtcggtgcgcgtcgcatcgtc
aacatacacgaggagacgaagaagatcaagaagatggtcgacggcaaggagcaggaagtc
gacaagaagtggcaatactttgagctcagcccctacaagtacaaaagttttgtcgagttt
gagcaaatggctctctcaataggttcgggtctcaagtcgctgggtctcgagccacaagac
aggctgcacctcttcgccgccactagcatgcaatggctggcttctgcccacggcgcgctt
tcccagtcaatggccattgttactgcctatgacacgctcggagaggagggcctcaagcac
tctatgcttcagaccaaagcaaaagtcatgtttaccgacccagagctgctgccccggctc
gtgaaacccatgaacgaggccaaggacgtcagagtagttgtttactgcacaaaaaacgac
cccaagcaaaaggatattgataccctcactcaggcgcatccccacttgaaagtcatcagc
tttgacgacctgatcaagctgggtgaggagaaccccgcagagccaattccgccaaaggca
gacgacctggcctgtatcatgtatacttctggatccactggaacccccaagggtgttatg
atcaagcaccgcaatgtcgttgctgccgtcgctggtgtcgatgttattgtaggaaagtac
cttggacctggcgatgtgctcatcacctatctccctgccgcacacatcctcgagttcgtg
tttgaaaacgccgttctctactggggaggcaccatgggttacggcacaatccgcacgctc
tccgaccaatcggtgcgaaactgtgctggtgacatccgtgagctgaagcccaccgtcatg
gttggtgttccccaggtatgggagaccatcaagaagggcatcatcaacaaggtcgaggca
ggaggcgcgctcaagagcaacatgttctggggtgccttcgcagctaagggtttcctcttg
ggctctggccttcccggtagtggtcttctcgacaccatcgtcttcaacaaggtcaaggag
gccacaggtggcaggctccgaatctgcatgaacggtggcggtcccattgcaaaggaaacc
cagcgcttcatctccattgccattacacccatgatcagcggttacggtttgaccgagact
tgcgccatgggtgcgctcatggatcctttggcttggaacgagaaggctcttggtgagatg
cccggatcaatcgagatgaagctagttgattttgccgatgctggatacttctccaccaac
aagcctcctcagggtgaaatctggattcgtggtggcggtgtcgttgatggctacctgaac
atgcccgaagagaccaaggaagccttcactgaagatggttggttcaagactggcgatgta
ggcgagttcaacgccaacggagaaatccgtatcatcgaccgcaagaagaaccttgtcaag
acgcttgctggagagtacattgcgctcgagaagctcgagtctgtctaccgatctgcgccc
attgtcgcaaatatctgcgtctacgctgctgaggaccgccagaagcccatcgccatcatt
gtgcccactgagccacagctcaagaagattgccgctcaagtcggcgtcactggtgaccac
cttgaggagctcgtccacgacaagaaaatcaactctgctgtgctgaagcagctgcaagac
gcgggtcaaaagggtggccttgccagctttgagatgattgaaggcgttgtcctagccgat
gaggaatggacaccacaaaacggcctgactaccgctgcgcagaagctcaaccgcaagggc
atcttggaacactacaagaaggaggtcgatcaggcttacggcaagtcttag

DBGET integrated database retrieval system