KEGG   Bifidobacterium scardovii: BBSC_2253Help
Entry
BBSC_2253         CDS       T03975                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bsca  Bifidobacterium scardovii
Pathway
bsca00511  Other glycan degradation
bsca00600  Sphingolipid metabolism
bsca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BBSC_2253
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBSC_2253
Enzymes [BR:bsca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BBSC_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: BAQ32333
Position
complement(2716667..2718214)
Genome map
AA seq 515 aa AA seqDB search
MAEFINQYAHEYWTRTSGDLAERRAPIATPVIESDHGDAVDVIIDPTRRYQRWEGVGAAI
TDSSASLFMSSMSPEQRHAILSEMFDPEQGGFSSVRISIGACDFSSQKYYSYDDLPEGVA
ADASLSYFSIGEGEPGAPDATKDLKNVVPVLQEILKINPAVKVMASPWSAPAWMKTSGVL
SGAGRLRLGEYVGNGYRYQDTIDYVYAQYFVKFIAAYAKYGIRINSVTMQNEPSNGCPWP
ITVWTPEELAKWGSEYLRPALDRTFPDVEIYFGDDSLRFFQRPVSDYMTPAQANAFAGVA
FHTYSGLPEWVHNGARQFPGWKVAMTERRCMLDETVDEASHVMFGEIGTWLVRNGMGLIN
LWNMALDEQGFPSYAGTSGRRGVITIDSSTGKVKRNLEYFMLRNYGQDVKVGSQRVASTN
RTPDGRHGGLGSVAFVADNGDLSGILYNPTGKDIEAAVEINGEGARWQKVTVPAYGTVSF
HKSNHAINETQAPADDEFKITYTPHPADDHDETLF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcatcaatcagtacgctcatgagtactggacgcgcaccagcggcgatctt
gcggagcgtcgcgccccgatcgccaccccggtgatcgaaagtgatcacggagacgccgtg
gatgtgatcatcgatccgacacgccgctaccagcgttgggagggcgtcggcgccgcgatc
accgattcctccgcgtccctgttcatgagctcgatgagccccgagcagcgccacgccatc
ctgtccgagatgttcgaccccgagcagggcggcttctcctccgtgcgcatctccatcggc
gcctgcgacttctccagccagaagtactactcctacgacgacctgcccgagggcgtggcc
gccgacgccagcctgagctacttctccatcggcgagggcgagcccggcgcccccgacgcc
accaaggacctcaagaacgtggtcccggtgctgcaggagatcctgaagatcaacccggcc
gtcaaggtcatggcctccccgtggtccgccccggcctggatgaagacctccggcgtgctc
tccggcgccggccgcctgcgcctcggcgagtatgtcggcaacggttaccgttaccaggac
accatcgattacgtgtatgcgcagtacttcgtcaagttcatcgccgcctacgccaagtac
ggcatccgcatcaactcggtgaccatgcagaacgagccgagcaacggctgcccgtggccc
atcaccgtgtggacccccgaggagctcgccaagtggggcagcgaatacctgcgcccggct
ctcgaccgcaccttccccgacgtcgagatctacttcggcgacgactccctgcgcttcttc
cagcgcccggtgagcgactacatgaccccggcccaggccaacgccttcgccggcgtcgcc
ttccacacctactccggcctgcccgagtgggtgcacaacggcgcccgccagttcccgggc
tggaaggtcgcgatgaccgaacgccgctgcatgctcgacgagaccgtcgacgaggccagc
cacgtcatgttcggcgagatcggcacctggctggtgcgcaacggcatgggcctgatcaac
ctgtggaacatggcgctcgacgagcagggcttcccgagctacgccggcacctccggccgc
cgcggcgtgatcaccatcgactcctccaccggcaaggtcaagcgcaacctcgagtacttc
atgctgcgcaactacggtcaggacgtcaaggtcggctcgcagcgcgtggcctccaccaac
cgcacgcccgacggccgccacggcggtctcggctcggtggccttcgtggccgacaacggc
gatctgtccggcatcctgtacaacccgaccggcaaggacatcgaggccgccgtcgagatc
aacggcgagggcgcccgctggcagaaggtcacggttccggcctacggcaccgtgagcttc
cacaagtccaaccacgcgatcaacgagacccaggccccggccgacgacgagttcaagatc
acctacaccccgcaccccgccgacgatcacgacgagacgctgttctga

DBGET integrated database retrieval system