KEGG   Blastococcus saxobsidens: BLASA_2141Help
Entry
BLASA_2141        CDS       T01752                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase 1
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00010  Glycolysis / Gluconeogenesis
bsd00030  Pentose phosphate pathway
bsd00051  Fructose and mannose metabolism
bsd00052  Galactose metabolism
bsd00680  Methane metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLASA_2141 (pfkA)
   00030 Pentose phosphate pathway
    BLASA_2141 (pfkA)
   00051 Fructose and mannose metabolism
    BLASA_2141 (pfkA)
   00052 Galactose metabolism
    BLASA_2141 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BLASA_2141 (pfkA)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BLASA_2141 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BLASA_2141 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCG03050
UniProt: H6RSU7
Position
2043268..2044293
Genome map
AA seq 341 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRKGVTEYGDEIVGFRDGWRGVLDGDTVPVDLAAVRGL
LPRGGTVLGTSRTNPYSVEGGPERVRETLGRLGIDALVPIGGEDTLGVATRLAETGVRMV
GVPKTIDNDLDATDYTFGFDTAVGVAMEAIDRLHTTGDSHHRTLVVEVMGRHAGWIALHA
GMAGGASVVLIPEHPFDVDGVVAHCLHRFESGYSPIVVVSEGATPRDGDLMLSTGDEDAF
GHVRLGGIGPALAALIEERTGRESRAVVLGHVQRGGTPSPFDRVLATRFGLAAVDAVHAG
ESGVMVALRGTDIVRVPLSTATAQLKLVPPERYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcatcctcaccggcggaggcgactgcccggggctgaacgccgtcatccgc
gccgtggtgcgcaagggggtgaccgagtacggggacgagatcgtcggcttccgcgacggc
tggcgcggggtgctcgacggcgacaccgtcccggtggacctcgccgcggtgcgcggcctg
ctgccccgtggcggcaccgtgctcggcacctcccgcaccaacccgtactccgtcgaaggc
gggccggagcgggtgcgggagaccctcgggcggctcgggatcgacgcgctcgtgccgatc
ggcggggaggacaccctgggggtggccacccggctggccgagaccggggtgcggatggtg
ggcgtgccgaagaccatcgacaacgacctggacgccaccgactacacgttcggcttcgac
accgccgtcggcgtggccatggaggccatcgaccggctgcacaccaccggggacagccac
caccgcacgctcgtcgtcgaggtcatggggcggcacgcgggctggatcgcgctgcacgcg
ggcatggccggcggggccagcgtcgtcctcatcccggagcacccgttcgacgtcgacggc
gtcgtcgcgcactgcctgcaccgcttcgagtcggggtactcgccgatcgtggtcgtctcg
gagggggccacgccgagggacggcgacctgatgctctcgacgggggacgaggacgcgttc
ggccacgtccggctgggtggcatcggcccggccctggcggcgctgatcgaggagcgcacc
ggccgggaatcgcgggccgtcgtcctcgggcacgtgcagcgcggcggcacgccgtcgccc
ttcgaccgggtgctggccacccggttcggcctggctgccgtggacgcggtgcacgccggg
gagagcggggtgatggtcgccctgcgcggcaccgacatcgtccgcgtacccctgtcgacg
gctacggcgcagctcaagctggtgccgcccgagcggtacgccgaagcggaggtgttcttc
ggctga

DBGET integrated database retrieval system