KEGG   Blastococcus saxobsidens: BLASA_3031Help
Entry
BLASA_3031        CDS       T01752                                 

Gene name
caiD
Definition
(GenBank) Carnitinyl-CoA dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00071  Fatty acid degradation
bsd00280  Valine, leucine and isoleucine degradation
bsd00281  Geraniol degradation
bsd00310  Lysine degradation
bsd00360  Phenylalanine metabolism
bsd00362  Benzoate degradation
bsd00380  Tryptophan metabolism
bsd00410  beta-Alanine metabolism
bsd00627  Aminobenzoate degradation
bsd00640  Propanoate metabolism
bsd00650  Butanoate metabolism
bsd00903  Limonene and pinene degradation
bsd00930  Caprolactam degradation
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
bsd01212  Fatty acid metabolism
Module
bsd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BLASA_3031 (caiD)
   00650 Butanoate metabolism
    BLASA_3031 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    BLASA_3031 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLASA_3031 (caiD)
   00310 Lysine degradation
    BLASA_3031 (caiD)
   00360 Phenylalanine metabolism
    BLASA_3031 (caiD)
   00380 Tryptophan metabolism
    BLASA_3031 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BLASA_3031 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BLASA_3031 (caiD)
   00281 Geraniol degradation
    BLASA_3031 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BLASA_3031 (caiD)
   00627 Aminobenzoate degradation
    BLASA_3031 (caiD)
   00930 Caprolactam degradation
    BLASA_3031 (caiD)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BLASA_3031 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCG03902
UniProt: H6RNF5
Position
complement(2901759..2902526)
Genome map
AA seq 255 aa AA seqDB search
MDERKVLVERRGAVQVITINRPSARNALDAEVATAVAAAVDELDADDQLRAGVLTGSGGT
FSAGMDLKAFLRGESPSLPGRGLCGITRTPPRKPLIAAVEGWALAGGFELVLACDLVVAG
RTARFGVPEVKRSLVAAGGAALLLPQRVPRAVALELLLTGEPIGAERAAAAGLVNRLVDE
GDAVDAAVELAGTIAANGPLAVAATKRIVQEAPGWAPEEAWARHDEVTAPVFTSEDAREG
STAFAERREPVWRGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgcaaggtcctggtggagcgccgcggcgccgtccaggtgatcaccatcaac
cggccgtcggcccgcaacgccctcgacgccgaggtggccacggcggtcgccgccgcggtc
gacgagctcgacgccgacgaccagctgcgggccggcgtgctcaccggctccgggggcacc
ttctcggccgggatggacctcaaggcgttcctgcgcggggagagcccgtcgctgcccggc
cgcgggctgtgcgggatcacccgcacgccgccacgcaagccgctgatcgccgccgtcgag
ggctgggcgctggccggcggcttcgagctggtcctcgcctgcgacctggtcgtcgccggc
cggacggcgcggttcggcgtcccggaggtcaagcggtcgctggtggccgccggaggtgcc
gcgctgctcctgccgcagcgcgtcccgcgcgccgtggcgctggagctgctgctgaccggg
gagccgatcggcgcggagcgggccgccgccgccgggctggtgaaccggctggtggacgag
ggagacgccgtcgacgcagccgtggagctcgccgggacgatcgccgccaacggcccgctc
gcggtggccgcgaccaagcggatcgtccaggaggcgccgggctgggcacccgaggaggca
tgggcacggcacgacgaggtgaccgcgccggtgttcacgtccgaggacgcccgcgagggc
tcgaccgcgttcgccgagcggcgggagccggtctggcgcggtcgctga

DBGET integrated database retrieval system