KEGG   Blastococcus saxobsidens: BLASA_3885Help
Entry
BLASA_3885        CDS       T01752                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00500  Starch and sucrose metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLASA_3885 (glgB)
Enzymes [BR:bsd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BLASA_3885 (glgB)
Exosome [BR:bsd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLASA_3885 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 HC2 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CCG04716
UniProt: H6RXA5
Position
3750686..3753547
Genome map
AA seq 953 aa AA seqDB search
MTTDDRGEQPVAGKDDLQRAVDQKVTEAEAAAGGPVVNAEPAKKTTKRATAKKTAAAEPA
GGGAVPARKAAAKKAAPAKKAAPAKKAAAAKRTTAKKVAAAPTATEATPEPGSEDAPTTA
NPVVAPAPIAEPGSPSGEPAGQPEAPSPDPAEPSTPQAPGEGAGSRPASGAGSAEPAAPV
APVPADTASGAPDTGEQAGGLTAGTEVREVGEEDLRAIVEGWSRDPHGVLGAHRTGEEWV
VRTLRPDAVAVAVLDEDGTRYDATRLHDGGIYEASFPRQPGDYRIEVVYGDGEGGSTTHT
VDDPFRWLPTLGPLDEHLIREGRHERLWEVLGAHIRRYETPRGTVEGVSFAVWAPSARGV
KVTGDFDYWQARAYPMRHLGSSGVWEIFIPGAQVGTRYRYHVLGADGTWREKSDPLAFAT
EVPPLNASVVTESTYEWQDDAWLSQRAEAGWHQRPISVYEVHAGSWRQGLSYRELADELV
DYVVSAGFTHIEFMPLAEHPFGGSWGYQVTSYYAPTSRFGSPDDLRYLIDRAHQAGIGVI
VDWVPAHFPKDEWALARFDGTPLYEHGDPRRGEQLDWGTYVFDFGRSEVRNFLVANALFW
CKEFHVDGVRVDAVASMLYLDYSRDEWLPNKYGGRENLEAVAFLQEFNATVYREVPGVVT
IAEESTAWPGVTRPTHLGGLGFGFKWNMGWMHDSLGYVEREPIYRSYHHGQLTFSMHYAY
SENYVLPISHDEVVYGKGSMLRKMPGDRWQQLANLRAYLSYMWAHPGKQLLFMGSEFAQD
AEWAESRSLDWWHLDDPAHRGMLQLVTDLNGRYKEIDALWSQDVDPAGFQWIDANDASGN
VLSFLRYGSAAGGPATEDAPVDDAAPGGEPAAQGSALACVVNFSGSPHHEYRIGLPRPGQ
WREVLNSDGEGYGGSGVGNYGGVEAVAEPWHGQPYSATISAPPLGTVWFLHEG
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgaccgaggtgagcagcccgtggccggcaaggacgatctgcagcgcgcc
gtggaccagaaggtgaccgaggccgaggcagccgccggcggccccgtggtgaacgccgaa
ccggcgaagaagacgacgaagcgcgccacggcgaagaagaccgcggcggccgagccggcc
gggggcggcgcggtaccggcccggaaggcggcggcgaagaaggccgcgccggccaagaag
gcggcaccggcgaagaaggccgccgcagccaagcggacgacggccaagaaggtggcggcc
gcaccgacggccaccgaggcgacgcccgagcccggcagcgaggacgccccgaccaccgcc
aacccggtggtggccccggcgccgatcgccgagcccgggtcgcccagcggtgagccggcc
ggccagccggaggcgcccagccccgacccggccgagccgagcaccccgcaggcgcccggc
gagggtgccggcagccggccggcctcgggcgccggctccgccgagccggcggctccggtg
gcgcccgtcccggccgacaccgcgtcgggcgctccggacaccggcgagcaggctggtggc
ctgacggccgggaccgaggtccgggaggtcggcgaggaggacctgcgggcgatcgtcgag
ggctggtcccgcgacccgcacggggtgctcggcgcgcaccggaccggcgaggagtgggtg
gtgcgcacgctgcgccccgacgccgtcgccgtggccgtcctcgacgaggacggcacccgc
tacgacgccacccggttgcacgacggcgggatctacgaggccagcttcccgcgccagccg
ggcgactaccgcatcgaggtcgtctacggcgacggcgagggcggaagcaccacccacacc
gtcgacgacccgttccgctggctgccgacgctcggtccgctggacgagcacctcatccgc
gagggccggcacgagcggctgtgggaggtgctgggcgcgcacatccggcgctacgagacg
ccccgcggcacggtcgagggcgtctccttcgccgtctgggcgcccagtgcccgcggcgtc
aaggtgaccggcgacttcgactactggcaggcccgcgcctacccgatgcggcacctcggg
tcctccggcgtgtgggagatcttcatccccggcgcccaggtgggcacccggtaccgctac
cacgtcctgggtgctgacggcacgtggcgggagaagtccgacccgctcgccttcgccacc
gaggtcccgccgctgaacgcctcggtcgtcaccgagtcgacctacgagtggcaggacgac
gcctggctcagccagcgggccgaggccggctggcaccagcgtccgatcagcgtctacgag
gtgcacgccggctcgtggcggcagggcctgtcctaccgcgagctcgccgacgagctggtc
gactacgtcgtctccgctggtttcacccacatcgagttcatgccgctggccgagcatccc
ttcggcggctcctggggctaccaggtcacctcctactacgcgcccacgtccaggttcggc
agcccggacgacctgcgctacctgatcgaccgcgcccaccaggccgggatcggcgtcatc
gtggactgggtgccggcgcacttccccaaggacgagtgggcgctggcccgcttcgacggc
acgccgctctacgagcacggtgacccgcgccgcggcgagcagctggactggggcacgtac
gtcttcgacttcgggcgctccgaggtccggaacttcctggtcgccaacgcgctgttctgg
tgcaaggagttccacgtcgacggtgtccgcgtcgatgccgtggcctcgatgctctacctg
gactactcgcgcgacgagtggctgcccaacaagtacggcggccgggagaacctggaggcc
gtcgccttcctccaggagttcaacgccaccgtctaccgcgaggtccccggcgtggtcacc
atcgccgaggagtccaccgcctggccaggggtcacccgaccgacgcacctgggcgggctg
ggcttcggcttcaagtggaacatgggctggatgcacgactcgctcggctacgtcgagcgg
gagccgatctaccgcagctaccaccacggccagctcacgttctcgatgcactacgcgtac
agcgagaactacgtcctcccgatcagccacgacgaggtcgtctacggcaagggttcgatg
ctgcggaagatgccgggtgaccggtggcagcagctggccaacctgcgcgcgtacctctcc
tacatgtgggcccacccgggcaagcagctgctgttcatggggtcggagttcgcccaggac
gccgagtgggccgagagccgctcgctggactggtggcacctcgacgatcccgcccaccgc
ggcatgctgcagctggtcaccgacctcaacggccggtacaaggagatcgacgcgctctgg
tcgcaggacgtcgaccccgccggcttccagtggatcgacgccaacgacgcgtcgggcaac
gtgctgtcgttcctgcgctacggatccgcggccggcgggccggcgaccgaggacgcgccg
gtggacgacgccgccccggggggcgagccggccgcgcagggttccgcgctcgcctgcgtg
gtcaacttctccggctcgccgcaccacgagtaccggatcggcctgccccggcccggacag
tggcgcgaggtcctcaacagcgacggggagggttacggcgggtccggcgtcggcaactac
ggcggcgtggaggccgtggccgagccctggcacggccagccgtactcggcaaccatctcc
gctcccccgctgggcaccgtctggttcctgcacgaaggctga

DBGET integrated database retrieval system